KEGG   Microbulbifer thermotolerans: A3224_04940Help
Entry
A3224_04940       CDS       T04393                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd00970  Aminoacyl-tRNA biosynthesis
mthd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A3224_04940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mthd03029]
    A3224_04940
Enzymes [BR:mthd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A3224_04940
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A3224_04940
Mitochondrial biogenesis [BR:mthd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A3224_04940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AMX02015
UniProt: A0A143HJW3
LinkDB All DBs
Position
complement(1185296..1186771)
Genome map
AA seq 491 aa AA seqDB search
MHQLTIAEIIRGLRDKQFSSAEITRHLLDRIQQLDGHYNSFITVTEEQALEQAAAADRRL
AAGEAPALCGVPIAHKDLFCTRGVRTSCGSKMLDNFAPPYDATVVEKLNAAGSVTLGKTN
MDEFAMGSSNETSYYGPVKNPWNVDCVPGGSSGGSAAAVAAQLVPGATATDTGGSIRQPA
ALTNTTGLKPTYGRVSRWGMIAFASSLDQGGPIARNAEDCAYLLSAMAGHDGKDSTSLNR
PAEDYTRSLNDSIADLKIGVPKEYFGEGLNADVAARVETALKAFEALGAKLVEISLPHTD
LAVPAYYVIAPAEASANLSRFDGVRYGYRCADPKDLRDLYMRSRGEGFGEEVQRRILVGT
YALSAGYYDAYYNKAQQVRRLIKQDFVQAFEKVDVIMGPTSPNPAFAIGAKKADPVAMYL
EDIYTIAANLAGLPAMSLPCGLVNNLPVGLQIIGNYLCEARMLNIAHQYQQVTDWHTASA
FSIETAGSAGE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaattaaccatcgccgagattattcgcgggctgcgcgacaaacagttctccagc
gccgagatcacccgccatttactcgatcgcatccagcaactggatggccactacaacagt
tttatcaccgtcaccgaagagcaggcgctggaacaggccgcggcggcggaccggcgcctg
gccgccggcgaggcgccggcgctctgcggcgtacccatcgcccataaagatctcttctgc
acccggggtgtgcgcaccagctgcggttcgaagatgctcgataatttcgcgccgccctat
gacgccactgtggtggaaaaactcaacgccgccggcagcgtgaccctgggtaaaaccaat
atggacgagttcgccatgggctcctccaacgaaaccagttactacggcccggtaaaaaac
ccctggaatgtcgactgtgttcccgggggctcttccggcggttccgccgccgcggtggct
gcgcagctggtccccggtgccaccgcaaccgacaccggcggctccatccgccagcctgcg
gccctgaccaacaccaccggcctcaaacccacttacgggcgcgtgtcccgctggggcatg
atcgcctttgcttccagcctcgaccagggcggccccatcgcccgcaacgccgaggattgc
gcctatcttctgtcggccatggccggccacgacggcaaggactccaccagcctgaaccga
ccggcagaggactatacgcggagcctgaatgactccatcgcggacttaaaaatcggtgtg
ccgaaagagtatttcggggaaggactgaatgcggatgtggccgcacgggtggaaaccgca
ctgaaggcgttcgaagcgctgggtgccaaactggttgagatcagcctgccgcacaccgac
ctggcagtcccagcctattacgtaatcgcaccggcagaggcatccgccaacttatcccgc
ttcgacggcgtgcgctacggctaccgctgcgcggacccgaaagatctgcgcgatctctat
atgcgctcccgcggcgagggcttcggcgaggaggtgcagcgccgcattctggtcggcacc
tacgcactgtccgccggctattacgatgcctattacaacaaggcgcaacaggtgcgccgc
ctgatcaagcaggattttgtacaggctttcgaaaaagtggatgtcatcatggggccgaca
tcgcccaacccagcgttcgcgatcggcgccaaaaaagcagacccggtagccatgtatttg
gaggacatttacaccatcgccgcgaacctggcgggactgcctgccatgtccctgccctgc
ggactggtgaacaatctgccggtgggcctgcagatcatcggcaactacctctgtgaggcg
cgcatgctcaacatcgcgcatcagtatcaacaggtcaccgattggcacacagcgagcgca
ttctcaatagaaacagctggcagcgcaggagaataa

DBGET integrated database retrieval system