KEGG   Microbulbifer thermotolerans: A3224_05395Help
Entry
A3224_05395       CDS       T04393                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd00020  Citrate cycle (TCA cycle)
mthd00190  Oxidative phosphorylation
mthd00650  Butanoate metabolism
mthd01100  Metabolic pathways
mthd01110  Biosynthesis of secondary metabolites
mthd01120  Microbial metabolism in diverse environments
mthd01130  Biosynthesis of antibiotics
mthd01200  Carbon metabolism
Module
mthd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mthd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mthd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A3224_05395 (sdhA)
   00650 Butanoate metabolism
    A3224_05395 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A3224_05395 (sdhA)
Enzymes [BR:mthd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A3224_05395 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     A3224_05395 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 HI0933_like DAO Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AMX02089
UniProt: A0A143HK38
LinkDB All DBs
Position
1286490..1288262
Genome map
AA seq 590 aa AA seqDB search
MANMRTISFDGIVIGGGGAGMRAALQMAQSGFKTAVITKVFPTRSHTVSAQGGITCAIAS
ADPQDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTEEGRIYQRP
FGGQSKDFGRGGQAARTCAAADRTGHALLHTLYQNNVKHNTVFLNEWFAIDLVKNQDGAV
VGVIAMRIEDGEVVFIKSKATVFATGGAGRIYASTTNAHINTGDGVGMALRAGLPVQDIE
MWQFHPTGIYGAGVLVTEGCRGEGGYLINKDGERFMERYAPNAKDLASRDVVARSMILEI
LDGRGAGPNGDHVFLKLDHLGEEVLHSRLPGICELAKTFAHVDPVKDPIPVVPTCHYMMG
GIPTNIHGQALTQDAAGNDQVVDGFYACGEVACVSVHGANRLGGNSLLDLVVFGRASGLF
IEKALREGVEHREASESDIEAAMARLNRLENSNDGEKASVLRGELQNVMQNHFGVFRRGD
YMAEGVKKLEALRERIANVRLDDKSRAFNTARVEALELQNLLEVAEATAIAAEARTESRG
AHAREDFQERDDENWLCHSMFFPQEKRVGKRAVNFAPSTVEAFEPKARTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacatgcgaactatttcttttgatgggattgtgattggtggcggtggcgccggc
atgcgcgctgcgctgcaaatggcacagtccggcttcaagactgcggtgatcactaaagtg
ttcccgacccgctcgcacactgtgtccgcccagggggggatcacctgtgctatcgccagc
gcggatccgcaggatgactggcgctggcatatgtacgacacagtaaaaggctccgattat
atcggtgaccaggatgccattgagtatatgtgctccgtggggcccgaggcggtgttcgag
ctggagcacatggggctgcctttctcccgtaccgaggaaggccgcatctatcagcgcccc
ttcggtggccagtccaaggatttcggccgcggcggtcaggctgcgcgtacctgtgctgcc
gctgaccgcacaggccatgccctgctgcacacgctgtatcagaacaacgtcaagcacaac
actgtctttttgaacgaatggtttgccatcgatctggtgaaaaaccaggacggcgccgtg
gtgggcgtgatcgccatgcgtatcgaagacggtgaagtcgttttcatcaaatcgaaggcc
actgtatttgccactggcggcgctggccgtatttacgcttccaccaccaatgcccatatc
aataccggtgacggtgtgggaatggcgctgcgcgccggtttgccggtgcaggatatcgag
atgtggcaattccacccgaccggcatctacggtgccggcgtgctggtgaccgagggttgc
cggggtgagggcggctatctgatcaataaggacggcgagcgctttatggagcgctatgcc
cccaacgcgaaggacttggcctcccgcgatgtggtggcccgctccatgattctggaaatt
ctggatggtcgcggtgccggccccaatggcgatcacgtattcctgaagctggatcacctc
ggtgaagaggtactgcacagccgcctgccgggtatctgtgagctggccaagacctttgct
catgtggacccggtaaaagatccgatcccggtagtgcccacctgtcactatatgatgggc
ggtatccccaccaatattcacggccaggccctgacccaggatgccgccggcaacgaccaa
gtggtagacggcttctacgcctgcggcgaagtggcctgtgtatccgtgcacggtgccaac
cgcttgggcggcaactcgctgctggacttggtggtatttggccgcgcttccggcctcttt
attgaaaaagcgctccgcgaaggtgtcgagcaccgcgaggccagcgaatccgacatcgaa
gcggccatggcgcgcctgaatcgcctggaaaacagcaatgatggcgagaaagcatcggtg
ctgcgcggagagctgcagaatgtgatgcagaaccacttcggtgtattccgtcgcggcgat
tatatggccgaaggggtgaagaagctggaagcgctgcgcgagcgtattgccaatgtgcgc
ctggacgacaaaagtcgcgccttcaataccgcccgtgtcgaggcactggaactgcagaac
ctgctggaagtggccgaggccaccgcgatcgccgcagaggcccgtaccgagagccgcggc
gcccatgcccgcgaagacttccaggagcgcgacgacgaaaactggctgtgccactccatg
ttcttcccgcaggaaaaacgtgtcggcaagcgcgcggtcaacttcgcgcccagcaccgtg
gaagccttcgagcccaaggctcggacctactaa

DBGET integrated database retrieval system