KEGG   Microbulbifer thermotolerans: A3224_05400Help
Entry
A3224_05400       CDS       T04393                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd00020  Citrate cycle (TCA cycle)
mthd00190  Oxidative phosphorylation
mthd00650  Butanoate metabolism
mthd01100  Metabolic pathways
mthd01110  Biosynthesis of secondary metabolites
mthd01120  Microbial metabolism in diverse environments
mthd01130  Biosynthesis of antibiotics
mthd01200  Carbon metabolism
Module
mthd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mthd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mthd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A3224_05400 (sdhB)
   00650 Butanoate metabolism
    A3224_05400 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A3224_05400 (sdhB)
Enzymes [BR:mthd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A3224_05400 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     A3224_05400 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AMX02090
UniProt: A0A143HKU1
LinkDB All DBs
Position
1288353..1289057
Genome map
AA seq 234 aa AA seqDB search
MLKVSIYRYNPETDKAPYMQDYELDTQGKDLMVLDVLELLKAEDPTLSFRRSCREGVCGS
DGMNISGRNGLACTTPLSVAAPKGKLVLRPLPGLPVIRDLVVDMEQFYEQYRKIEPYLQN
DTPAPAIERLQSPEEREKLDGLYECILCACCSTACPSFWWNPDKFIGPAGLLQAYRFLAD
SRDTATDERLSKLDDPFSVFRCHGIQNCVNVCPKGLNPTRAIGHIRNMLLTRAV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtaagcatttaccgttacaacccggagactgacaaagctccttacatgcag
gactacgagctggatacccagggcaaagacctgatggtgctggacgtgctggaactgctg
aaagccgaggacccgaccctgtctttccgccgctcctgccgcgaaggggtatgtggttcc
gacggtatgaatatctccggtcgaaacggcctggcctgcactacccccctctcggtggcg
gcgcccaaaggtaaactggttttgcgtcctctgcctggactgccggtgatccgcgatctg
gttgtggatatggagcagttctacgagcagtacagaaagatcgaaccctacctccagaac
gatactccggcaccggcgattgagcgcctgcagagcccggaagagcgcgagaaactcgac
ggtctctacgagtgtattctgtgcgcctgctgttccaccgcctgtccgtctttctggtgg
aatccggacaaattcatcgggccggccggtttgctgcaggcttaccgtttcctggcggac
agtcgtgatactgctactgacgagcgcctgtccaagctggatgatcccttcagcgtattc
cgctgtcacggtattcagaattgtgtgaatgtgtgtcccaaggggctgaaccctacccgc
gctataggtcatatccgcaatatgttgctgacccgcgcggtatag

DBGET integrated database retrieval system