KEGG   Microbulbifer thermotolerans: A3224_06745Help
Entry
A3224_06745       CDS       T04393                                 

Definition
(GenBank) glutathione S-transferase
Organism
mthd  Microbulbifer thermotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C GST_N GST_C_3 GST_C_2 MukB_hinge GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AMX02319
UniProt: A0A143HKS2
LinkDB All DBs
Position
complement(1600394..1601008)
Genome map
AA seq 204 aa AA seqDB search
MKIYEFASAPNCRRVRMYLAEKGIDNIEFVQVDITKGENLTEDYRRRDINGKVPVLELDD
GTCIAESVAIQRYFEELYPEPPLFGRDPKEKALVEMWHRRADLNMMMNIGGCFQHGTGFF
KDRMKVFPDFGEECGKKALQFFDLLDHHLADNQYLVGDYLSVADLSMLCILDFGKVVQLR
PTPEKYPHLARWHGQLSARPSAKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctacgagttcgccagcgcgcccaactgtcgccgggtacgcatgtacctggcg
gaaaaaggcatcgacaatatcgagtttgttcaagtggacatcaccaagggggaaaatctc
actgaggattaccggcgccgggacattaacggcaaagttccggtgctggaactggacgac
ggtacctgcatcgcggaatccgtcgccatccagcgctatttcgaagagctgtacccagaa
ccacccctctttggccgcgatcccaaagagaaagcactggtagagatgtggcaccgccgc
gccgatctgaacatgatgatgaatatcggcggctgctttcagcacggcaccggcttcttt
aaagaccgcatgaaagtattccccgactttggcgaagagtgcggcaagaaggcactgcaa
ttttttgacttgctggaccaccatctggcggataaccaatacttggtaggggattaccta
tcggtagcggatctcagcatgctgtgcatactggatttcggcaaagtcgtgcaattgcgg
cccaccccggaaaagtaccctcacctggcgcgctggcatggacaactgagcgcacgcccc
agtgccaaggcctga

DBGET integrated database retrieval system