KEGG   Microbulbifer thermotolerans: A3224_08710Help
Entry
A3224_08710       CDS       T04393                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A3224_08710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mthd01001]
    A3224_08710
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mthd02044]
    A3224_08710
Enzymes [BR:mthd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     A3224_08710
Protein kinases [BR:mthd01001]
 Serine/threonine kinases: Other
  Bacterial family
   A3224_08710
Secretion system [BR:mthd02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   A3224_08710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGE-sulfatase Pkinase Pkinase_Tyr Pkinase_fungal APH PEGA CarboxypepD_reg Kdo Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AMX02654
UniProt: A0A143HLQ8
LinkDB All DBs
Position
2067081..2069483
Genome map
AA seq 800 aa AA seqDB search
MEVVSNSSLEIPGYRILKKINQGGMSTVYLAIQRSVGRQVALKVMSPVLNADPVFSERFQ
REANIVGQLSHPNIVSIHDIGRYRSLNYIAMDYMPGGSVSDRLSKGALEPLEALNVVREI
AMALDHAHSKGYVHRDLKPENILFREDGSAVLTDFGVARAVARTTRMTSSGMVVGTPHYM
SPEQARGAAIDGRADLYSLGVVFYEMLTSAVPYQAEEAVAIAIKHLTDPIPRLPARHSLY
QSLIDHFLAKDPEHRFQRGLEVVDAIDQLLAALAGKPAAQTTQLNNTPVRVSSLLRALLL
TIYGTISDQLTRAWARWRDKPLNKKPVRAEQETLMRIHQVIRQAPVRKHRQWLFGSLVSV
TAVSAWLLFSTGGNEQQQLQNYPLLNGASALPARSPQPGTTGRSGTPKPKETPQERMTPV
AVEHPTVPNTAQVTSATGEAAARTEEGEADKQVAGTAQISAATESTPAFESEAPSPAQAA
SPEMEVYQLTVHPNPRDARVRIMNIAPRYQPGIELAPGRYDLEVSKPGYTTVRRWITIKD
GDLTIPVQLKRAWYHGKTFRSPLSSGEQGPEMVVVKGGQFRMGNDKRAVSSPAHKVTIAK
AFAISTHEITFDDYDRFADATGAALPGDEGWGRGSRPVINVSWHDAQQYAKWLSKETGKR
YRLASEAEWEYAARGGVQAPFWWGGDDPRGKANCRRGCASEFNGLFSFSSAPTGHYQANR
FGLFDTAGNVAEWVQDCFASGYSKHRSDARPVLISNCELRTVRGGSMRSPLKNISSDYRE
GLREDAMSREVGFRVVMELE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcgtcagcaacagctctctggaaattcctggctaccgtatcctgaaaaaaatc
aaccagggcgggatgtccacagtatatctcgcgatccagcgcagtgtgggccgccaagtt
gcgttgaaggtgatgtcgccggtgctcaacgcagacccggtgttcagcgagcgcttccag
cgagaggcaaatatcgtcgggcagctgtcccatcccaacatcgtcagcatccacgatatc
ggccgctaccgcagtctcaattacatcgccatggactatatgccaggcggatcggtatcc
gaccgtctgtcaaaaggcgctttagaaccgctggaggccctgaatgtggtccgtgaaatc
gccatggcactggaccacgcccacagtaaaggctacgtgcaccgggacttaaaaccggaa
aatatcctctttcgcgaagacggctccgcagtgttgacggatttcggcgtggcgcgggcc
gtggctcggacaactcgtatgaccagctccggtatggtggttggcactccccattacatg
agcccggagcaagcccgcggcgctgccattgacggacgcgccgacctctacagcctcggc
gtggttttctatgaaatgttaaccagcgccgtaccctaccaggcagaagaagccgtcgct
atcgcaatcaaacacttgacggacccaataccccggctgccggcacggcactctctttac
cagagtctgatcgaccactttctcgccaaggatcccgaacaccgcttccagcggggcctg
gaagtggtggacgctatagaccagctgctcgcagccctggccggcaaacccgctgcccaa
accacgcaactcaacaatacaccggtgcgcgtctccagcctgctgcgcgcccttcttcta
actatctacggcaccatcagtgaccagctgactagagcctgggcccgctggcgcgacaag
ccactaaacaaaaaaccagtgcgggctgagcaggaaaccctgatgcgcatccatcaggta
atccgccaagcgcctgtgcgcaagcaccgccagtggctgttcggtagcctggtcagcgtc
accgcggtatccgcttggctgcttttcagcacagggggtaatgaacagcaacagctgcag
aattaccctttattgaacggggccagcgcccttcccgcacgatctccgcaaccgggcaca
accggaagaagcggcacaccgaaaccgaaggaaacgccgcaggagcggatgacaccggta
gctgttgaacacccaacagtgccaaataccgcgcaagttacatccgctacaggcgaagcg
gctgcccggacagaggaaggggaagccgacaagcaggtcgcaggtacagctcagatttct
gccgcgaccgagtccacccccgcatttgagagtgaggccccctctcccgcccaagccgct
tccccggagatggaagtctaccagctcaccgtgcacccgaatcccagggacgcgagagtg
cgcatcatgaacatcgctccccgttaccagcccggcatcgaattggcaccgggcaggtac
gatctggaagtcagcaagccgggttacacaacggttcgtcgctggatcaccatcaaagac
ggcgacctgacaattccggtgcagctgaagcgagcctggtaccatggcaaaacattccgt
tctcccctgtcatctggtgaacagggtcctgaaatggtcgtggtcaaaggcggccaattc
cgtatgggcaacgacaaacgcgccgtctccagccccgcgcacaaggtaaccatcgctaaa
gcctttgccatctccacacacgaaatcaccttcgacgactacgaccgtttcgccgacgcc
actggcgccgcactgcccggtgatgagggttggggacgcggcagccggcctgtgatcaat
gtcagctggcacgatgcacagcaatacgcgaagtggttgtcgaaggagacaggaaaacgc
taccgcctggcaagtgaggcggagtgggagtacgctgccagaggtggtgtacaggccccc
ttctggtggggtggcgacgatccacggggaaaagccaactgccgccgcggctgtgccagt
gagtttaacgggctgttttctttctccagtgcgccaacgggacactaccaggccaatcgt
tttggcctatttgacactgccggaaatgtagccgaatgggtacaggactgctttgccagc
ggctacagcaaacaccgcagcgacgcccgcccagtcctaatatccaactgtgagctgcgc
acagttcgcggcggttccatgcgctcgccgctcaaaaatatcagttccgactaccgcgaa
ggcttacgcgaagacgccatgtcccgcgaagtgggctttcgcgtggtgatggagctcgaa
tag

DBGET integrated database retrieval system