KEGG   Microbulbifer thermotolerans: A3224_10070Help
Entry
A3224_10070       CDS       T04393                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
Organism
mthd  Microbulbifer thermotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C AlaDh_PNT_C Pyr_redox_2 F420_oxidored ADH_N_2 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AMX02877
UniProt: A0A143HMY9
LinkDB All DBs
Position
complement(2375374..2376405)
Genome map
AA seq 343 aa AA seqDB search
MQALAAQYVGNRSFEILEGRVDAPSAGEVRLRVGYVGICGTDMHIYHGLMDHRVQPPQVV
GHEMSGVVDAVGADVTGFSVGDRVVVRPLDYCGDCPACREGYSHICHNLKFMGVDSEGAF
QSYWNVKARTLHKLPEHVSLKQGALIEPLAVACHDVSRARLKAGEKAVILGGGPIGQLIA
QVAIGIGAEVMISEPSPERRSFATSNGVLAVNPVEQDLKSAVDEWTGGKGADVVFEVSGV
QPAVDVMTEIAAVRGRICMVAIHSSKPQVDVFKFFWRELELVGARVYEAEDFERAIDMVA
DGKIDLEPFISKVAQLDQIDSAFSSMDGNPSGMKALVSCGADG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctctagcagctcaatacgtcggtaaccgatcttttgaaatacttgagggacgt
gttgatgcgccctcggcgggtgaggtgcgcctgagagtcggctatgtcggtatctgcggt
accgatatgcacatctaccatggccttatggatcaccgcgtgcagccgccgcaagtggtg
gggcacgagatgtccggtgtagtggatgcggtgggtgcagatgttaccggttttagcgtc
ggcgatcgggtagtggttcgtccgctggattactgtggagactgtccggcgtgccgggaa
ggatacagtcacatctgtcataacctgaaattcatgggggtggactctgaaggcgcattc
cagagttactggaacgtcaaagccagaacgttacacaagctgccggagcatgtgtccctt
aaacagggcgctctgatcgagccgctggccgtggcctgtcacgatgtgtcgcgtgcccgc
ttaaaagccggtgagaaggcagtgattcttggtggtggacccattggtcagctgattgcg
caggtggcgatcggcatcggcgccgaagtcatgatatccgagccgagtccggaacgcaga
agcttcgccacaagtaacggcgtgttagcggtgaatcccgtcgagcaggatttaaagtct
gcggtagacgaatggaccggcggcaaaggtgccgatgtggtattcgaagtttccggtgtt
caacccgctgtggacgttatgactgaaattgccgctgtgcgcggccgtatctgcatggtg
gccattcattcgagcaagccgcaggtagatgtgtttaagtttttttggcgcgagctggag
ctggtgggcgcccgagtctatgaagcggaggacttcgagcgggcgattgatatggtggcg
gacggtaagatcgacctggagccttttatcagcaaggtggcgcagctggaccaaatcgat
agtgccttctccagcatggatggaaacccctccggtatgaaggctttggtgtcctgtggc
gccgatggctaa

DBGET integrated database retrieval system