KEGG   Microbulbifer thermotolerans: A3224_11210Help
Entry
A3224_11210       CDS       T04393                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd03030  DNA replication
mthd03430  Mismatch repair
mthd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    A3224_11210
   03430 Mismatch repair
    A3224_11210
   03440 Homologous recombination
    A3224_11210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mthd03032]
    A3224_11210
   03400 DNA repair and recombination proteins [BR:mthd03400]
    A3224_11210
Enzymes [BR:mthd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     A3224_11210
DNA replication proteins [BR:mthd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     A3224_11210
DNA repair and recombination proteins [BR:mthd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     A3224_11210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AMX03058
UniProt: A0A143HMX9
LinkDB All DBs
Position
2671567..2671989
Genome map
AA seq 140 aa AA seqDB search
MTRIDFYVLPGDQHRDADIFACRLAEKAYRAGLRVLLAVDDKTRANELDQLLWTFREDSF
LPHAPQSAGENAAVEINCGEEPGQHHGLLINLRSDVPGWFSRFERLAEIVVQQPDALARS
RTRFCHFRDRGYPLQSHKIN
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaatagacttctatgtactccccggtgatcagcaccgggacgccgatattttc
gcctgtcgcttggcggaaaaagcctaccgcgcgggcttacgcgtgctgctggcagtcgac
gacaaaacccgggctaacgaactggaccaactgctgtggactttccgcgaggacagcttc
ctgccccacgcgccgcagagtgcgggcgaaaacgcagcggtggaaatcaactgcggcgag
gaaccgggccagcaccacggtctgctgatcaacctgcgcagcgacgtccccggctggttc
agccgctttgagcgcctggcagaaatcgtcgtgcagcaaccggacgccctggcgcgttcc
cgaacgcgattctgtcacttccgcgatcgcggatatccgttacaatcccacaagatcaac
tga

DBGET integrated database retrieval system