KEGG   Microbulbifer thermotolerans: A3224_16200Help
Entry
A3224_16200       CDS       T04393                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A3224_16200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mthd02000]
    A3224_16200
Enzymes [BR:mthd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A3224_16200
Transporters [BR:mthd02000]
 Other Transporters
  Pores ion channels [TC:1]
   A3224_16200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_6 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AMX03924
UniProt: A0A143HQB7
LinkDB All DBs
Position
complement(3904292..3904924)
Genome map
AA seq 210 aa AA seqDB search
MAEELIFYTNPQSRGRIVRWMLEEVGVPYETKVLEYGTTMKSPEYLSINPMGKVPAIVHG
GRVVTECAAICAYLADVLPEAGLLPQTLDEKANYYRWLFFAAGPLESVLNNRAVFKEEPE
VEKQRMLGYGNFRDTLNALSVAVKANPYIAGDRFTAADVYVGSHIGWGLQFGTMESREEF
IRYFDRLRERPAFTRAMSLDDVQAKEISEG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggagctgatcttctataccaacccccaatcccgcggccgcatagtgcgctgg
atgctcgaagaagtgggagttccctacgagacaaaagtactggagtacggcactaccatg
aagtcgcccgagtacctgtccataaaccccatgggcaaggtgccagccatagtgcatgga
ggtcgtgtggtgaccgagtgtgcggcaatctgtgcttatctggcggatgtcctcccagag
gccgggcttttgccgcagacgttggacgaaaaggcaaattattaccgctggctctttttt
gccgcaggccctctggaatcagttctaaataacagggctgttttcaaggaggagccggag
gtggaaaaacaaaggatgctgggttatggcaatttccgggatacgctgaatgccctgtcc
gtcgccgtaaaggccaacccctatattgccggtgaccgttttaccgcggccgatgtctat
gtgggttcccatattggctggggcctgcaatttggcaccatggaaagccgggaagaattt
atccgctatttcgaccgccttcgggagcgcccggcctttacgcgggcaatgtccttggac
gatgtccaggcaaaggaaatcagcgagggctga

DBGET integrated database retrieval system