KEGG   Methanosarcina thermophila CHTI-55: MSTHC_1352
Entry
MSTHC_1352        CDS       T03891                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mthe  Methanosarcina thermophila CHTI-55
Pathway
mthe00300  Lysine biosynthesis
mthe01100  Metabolic pathways
mthe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mthe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSTHC_1352
Enzymes [BR:mthe01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSTHC_1352
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N AlaDh_PNT_C 2-Hacid_dh_C 3HCDH_N Shikimate_DH
Other DBs
NCBI-ProteinID: AKB15670
UniProt: A0A0E3NGG8
LinkDB
Position
1672970..1673749
AA seq 259 aa
MALLTPDDLRDINKQLQEADSIVRRVTGLDIKGICKTLYGTSPNSEKIGIVPVTAGNGII
KNFSASLHAITQYFGFDSFVTDMSDVSGYYEAVQSGANIILMADDHTFLAHNLKNGKIAN
NQPSTGIIYAEIASRNQKTDSKDVLVVGLGKVGFPGAAHLVHKGFRVYGYDTDRTLLEQA
VSSLGIIPLDIESPKRFSTFFEATPCANTIPETLLSENCVLSTPGIPCAISEELRLKYNV
QLVMEPLGIGTASMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcactcttaaccccagacgatctgagagatattaacaaacaacttcaggaagctgat
tctattgtacggagagtaaccggacttgacataaaaggcatctgcaaaaccctctacggc
acctctccgaattctgaaaaaatcggtatcgtgcctgtaaccgcaggaaacggcataata
aaaaatttttcggcttccctgcatgcaattacgcagtacttcggatttgacagttttgtt
acggatatgtcggatgtcagcggctattatgaagccgttcaaagcggagccaatattatc
ctgatggcagatgaccacacctttcttgcgcataacctgaaaaacggaaaaatagccaac
aaccagccctcaaccggcataatctatgctgaaatcgcctccaggaatcagaaaaccgat
tcaaaggatgtactggttgtggggctcgggaaagtaggtttccccggagcagcacacctt
gtgcacaaaggtttcagggtatatgggtatgatactgatagaaccctcctggagcaagcg
gtttcaagccttggaattattcctctcgacattgaaagcccaaaaaggttttccactttt
tttgaggcgaccccatgtgcaaacacgattcctgaaactttactctcagaaaattgtgtg
ctttccacccctggaattccctgtgcaatctcagaagagcttcgactgaaatacaatgtg
caacttgtaatggagccccttggaataggaactgcatcgatgttgtattctgtgctgtga

DBGET integrated database retrieval system