KEGG   Methanosarcina thermophila CHTI-55: MSTHC_2132
Entry
MSTHC_2132        CDS       T03891                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
mthe  Methanosarcina thermophila CHTI-55
Pathway
mthe00521  Streptomycin biosynthesis
mthe00523  Polyketide sugar unit biosynthesis
mthe00525  Acarbose and validamycin biosynthesis
mthe01100  Metabolic pathways
mthe01110  Biosynthesis of secondary metabolites
Module
mthe_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mthe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MSTHC_2132
   01055 Biosynthesis of vancomycin group antibiotics
    MSTHC_2132
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MSTHC_2132
   00525 Acarbose and validamycin biosynthesis
    MSTHC_2132
Enzymes [BR:mthe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     MSTHC_2132
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 NAD_binding_10 NmrA
Other DBs
NCBI-ProteinID: AKB16450
UniProt: A0A0E3NJ95
LinkDB
Position
complement(2639372..2640328)
AA seq 318 aa
MKLLVTGGCGFIGSNFIRYMLEKYPDYQIINLDKLTYAGNPANLKDVENNPNYSFVKGDI
CDPLIVNEVMKEADQVVHFAAESHVDRSIEDGSVFVRTNVLGTNTLLQSALANNIKKFIH
ISTDEVYGSIAEGSYTETDNLNPSSPYSSSKAGSDLLAMSYYTTYGLPVCITRCTNNFGP
YQYPEKLIPFFISRLMDGKKVPVYGTGMNIRDWIYVEDHCSAVDFVLHNGSSGEIYNIRG
GNELTNLEITYRLLKMLDKDESSIEYVEDRKGHDFRYSLDGSKLEKMGWKPRYDFDAALE
QTVKWYVENRWWWEPLKH
NT seq 957 nt   +upstreamnt  +downstreamnt
ttgaaactgttggttactggcggctgcggattcataggcagtaattttatccgttacatg
ctggaaaaatatccggattatcaaattataaatcttgataaactgacatatgcaggaaac
ccagccaacctaaaagatgttgaaaataacccaaattattcttttgtcaaaggtgatatc
tgcgaccctcttatagtcaatgaagtaatgaaagaagcagatcaggttgtccatttcgca
gctgaaagccatgttgaccgctcaatagaggacggctcagtttttgtcagaacaaatgtg
cttgggacaaataccctcctccagagcgcccttgcaaataacataaaaaagttcattcat
atttcaactgatgaagtgtatggaagcatagcagagggttcctataccgaaaccgataat
ctgaatccttcaagcccctattcttcaagcaaagcaggctcagatcttcttgcaatgtcc
tactatacaacctatggtctgcccgtttgcataacccgatgcacaaacaactttgggccc
tatcagtatcctgaaaaattaattccttttttcattagtagattaatggatgggaaaaaa
gtccctgtttacggaacaggcatgaacattagggactggatctatgtcgaagatcactgt
tctgcagtcgactttgtcctccacaacggcagcagcggagaaatctacaacataagaggt
ggaaacgaacttacaaacctcgaaattacttaccgccttcttaaaatgcttgataaagac
gaatcctcaatcgagtatgttgaagaccggaaaggtcacgattttagatattcgctcgac
ggcagcaaactggagaaaatgggttggaaacccagatatgattttgatgcagctctggaa
cagacggtcaaatggtatgtagaaaatcgatggtggtgggaaccattaaaacactaa

DBGET integrated database retrieval system