KEGG   Mycolicibacterium thermoresistibile: 4412656_00019Help
Entry
4412656_00019     CDS       T05542                                 

Gene name
pknB_2
Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mthn  Mycolicibacterium thermoresistibile
Brite
KEGG Orthology (KO) [BR:mthn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mthn01001]
    4412656_00019 (pknB_2)
Enzymes [BR:mthn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4412656_00019 (pknB_2)
Protein kinases [BR:mthn01001]
 Serine/threonine kinases: Other
  Bacterial family
   4412656_00019 (pknB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Haspin_kinase Kinase-like RIO1
Motif
Other DBs
NCBI-ProteinID: SNW16228
LinkDB All DBs
Position
1:complement(17995..19266)
Genome map
AA seq 423 aa AA seqDB search
MTARVGVTLSGRYRLQRLIATGGMGQVWEGVDSRLGRRVAIKVLKAEFSDDPEFVERFRA
EARTVAMLNHPGIASVYDYGETDIDGSGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALD
MLEQTGRALQVAHTAGLVHRDVKPGNILITPTGQVKLTDFGIAKAVDAAPVTQTGMVMGT
AQYIAPEQALGHDATAASDVYSLGVVGYEAVSGRRPFTGDGALTVAMKHIKETPPPLPAD
LPPNVRELIEITLVKNPGMRYRNGGQFADAVAAVRSGRRPPRPNQAPSINRAAPAAIPSG
AQVRAAATGVRPRPAQHRPPPRRTFSPGQRALLWAAGVLGALAIIIAILIVLNAQERREQ
QSPPPTVTTTVTEPAPGALPRFEPTGFGPDETPVPETGPGPDTIEWAADPAAPRPPDLEQ
TLP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcccgcgtcggagtgacgctgtccgggcggtaccggctgcagcggctcatcgcc
accggcggcatgggccaggtctgggagggtgtggactcccggctgggccgccgcgtcgcg
atcaaggtgctcaaggccgagttctccgacgacccggagttcgtcgaacggttccgtgcc
gaagcccgcaccgtcgcgatgctcaaccatcccggcatcgccagcgtgtacgactacggc
gagaccgacatcgacgggtcgggccgcaccgcctacctggtgatggaactggtcaacggc
gagccgctgaactcggtgctcaaacgcaccgggcggctgtcgctgcggcacgcgctggac
atgctcgagcagaccggccgggccctgcaggtcgcgcacaccgccgggctggtgcaccgc
gacgtcaaacccggcaacatcctgatcaccccgaccgggcaggtgaagctcaccgacttc
ggcatcgccaaggcggtcgacgccgccccggtcacccagaccggcatggtgatgggcacc
gcccagtacatcgccccggaacaggcgctgggccacgacgccaccgcggccagcgatgtc
tactcgctcggtgtggtcggctacgaggcggtgtcgggccgccggccgttcaccggggac
ggcgcgttgaccgtcgcgatgaagcacatcaaggagacaccgccaccgctgcccgccgat
ctgccacccaacgtgcgggagctgatcgagatcacgttggtgaagaacccgggcatgcgg
taccgcaacggtggtcagttcgccgacgccgtcgccgcggtgcggtccggccgccgcccg
ccgcgccccaaccaggcgccgtcgatcaaccgggccgccccggccgccatcccgtccggg
gcgcaggtccgcgccgccgccaccggtgtccggccgcgtcccgcccagcaccgcccgccg
ccgcggcgcaccttctctccgggtcagcgcgcgctgctgtgggccgccggggtgctcggc
gcgctggcgatcatcatcgcgatcctcatcgtgctcaacgcccaggaacggcgcgaacag
cagtcgccgccgccgacggtcaccaccaccgtcaccgaaccggcgccgggggcgctgccg
cggttcgagcccaccgggttcggtcccgacgagactccggtaccggaaaccgggcccgga
ccggacacaattgagtgggctgcggatcccgccgcgccccgaccaccagatctcgaacag
acactgccatga

DBGET integrated database retrieval system