KEGG   Mycolicibacterium thermoresistibile: 4412656_01707Help
Entry
4412656_01707     CDS       T05542                                 

Gene name
truB
Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
mthn  Mycolicibacterium thermoresistibile
Brite
KEGG Orthology (KO) [BR:mthn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mthn03016]
    4412656_01707 (truB)
Enzymes [BR:mthn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     4412656_01707 (truB)
Transfer RNA biogenesis [BR:mthn03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    4412656_01707 (truB)
 Prokaryotic type
    4412656_01707 (truB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C TruB_C_2 DKCLD
Motif
Other DBs
NCBI-ProteinID: SNW17896
LinkDB All DBs
Position
1:1826523..1827428
Genome map
AA seq 301 aa AA seqDB search
MKTPPPAGLVVVDKPGGLTSHDVVGRCRRLFGTRKVGHAGTLDPMATGVLVIGIERATKI
LGLLAAGDKSYSATIRLGQSTSTDDAEGELLQTVSAIHLTDAEIEAAVGALRGDIEQVPS
AVSAVKIGGQRAYKLAREGRRVELAPRPVRIDRFEVLAIRHHETTPGDGVVDVDVEVDCS
TGTYIRALARDVGAALGVGGHLTVLRRTRVGRFGLDEARTLDELAERPQLSYTLDEACLL
AFPRRDLTAAEAEAAGHGRALPPAGIDGVYAATAPDGRVIALLRDGERRTTSVVVLRPAT
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacgccgccaccggccggcctggtcgtcgtcgacaaaccgggcggcctgaccagc
cacgatgtcgtcggccgctgtcggcggctgttcggcacccgcaaggtcggacatgccggc
accctggacccgatggccaccggggtgctcgtcatcggcatcgaacgggccaccaagatc
ctcgggctgctcgccgcgggggacaagtcgtattccgccaccatccggctcggccagtcg
acaagcaccgacgacgccgaaggtgagctgctgcagacggtttcggcaatccacctcaca
gacgcggagatcgaggccgcggtgggcgcgctgcgcggggacatcgagcaggtgccgtcg
gcggtgagcgcggtcaagatcggcggacagcgggcctacaaactcgcgcgggagggacgc
cgggtcgagctggcgccgcggccggtgcggatcgaccggttcgaggtgctggcgatccgc
caccacgagacgacgccgggggacggtgtggtggatgtcgacgtggaggtggactgttcg
accggcacctacatccgcgccctggcccgcgacgtcggcgccgcgctcggcgtcggcggc
catctgaccgtgttgcggcgcacccgggtcggccggttcgggctggatgaggcccgcacc
ctcgacgaactcgccgagcggccgcagctgagctacaccctggatgaggcctgcctgttg
gcgttcccgcgccgcgatctgaccgccgccgaggccgaggcggccggccacggccgcgcg
ttaccgcccgccggcatcgacggggtgtatgcggccaccgcgcccgacggccgggtgatc
gcgctgctgcgcgacggtgagcgccggaccacgtcggtggtggtgctgcgtccggcgacg
ctgtag

DBGET integrated database retrieval system