KEGG   Mycolicibacterium thermoresistibile: 4412656_03045Help
Entry
4412656_03045     CDS       T05542                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
mthn  Mycolicibacterium thermoresistibile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: SNW19209
LinkDB All DBs
Position
1:3224398..3225852
Genome map
AA seq 484 aa AA seqDB search
MHPEELFIGGEWATPSSAQRIEVISPHTEEPVAAVAAACPDDVDRAVAAARAAFDTGPWP
RMDPAERVAVIRGLAERYGERRSELAELITAQIGAPISFAQRAQVGLPWTMMSAFCTLAE
NHPWQQTRAGMYGADVHVRREPVGVVAAIVPWNMPQFLIVTKLIPALLAGCTVVLKPAPE
SPLDALLLAELIADSGIPSGVVNVLPGPAGVGERLVRHPGVDKVSFTGSTAAGRAVAAAA
AAGLKRVSLELGGKSAAVVLSDADPAAVATAVRSASLSNSGQICNALTRILMPAGRAAEF
TDALAAEMESLVIGDPTDAETQIGPLVARRQQERVRGYIEAGCAEGARLVTGGPGLPAGV
DRGWYVQPTLFADADNSMRIAREEIFGPVLTVIPYPDEDAAVAIANDSDYGLAGSVFTAD
TERGLAIAARIRTGTFGVNQGYTMDPFAPFGGVKGSGYGRELGPEGIDAYTDVKSISVAP
ASTT
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcccgaggagctgttcatcggtggcgagtgggcaacgccgagcagcgcacagcgc
atcgaggtgatctcaccgcacaccgaggaacccgtcgccgcggtggcggccgcctgcccc
gatgatgtcgaccgggcggtcgccgcggcgcgggcggcgttcgacaccggaccgtggccg
cggatggatccggccgaacgcgtcgcggtgatccgagggctggcggaacgctacggcgag
cggcgatccgagctcgccgagctcatcaccgcgcagatcggcgcaccgatcagcttcgcc
cagcgcgcccaggtcgggctgccgtggacgatgatgtcggccttctgcaccctggccgag
aaccatccgtggcagcagacccgggccgggatgtacggggccgatgtgcacgtgcgacgg
gagccggtgggggtggtggcggcgatcgtgccgtggaacatgccgcagttcctgatcgtc
accaagctgattccggcgctgctcgccgggtgcaccgtcgtgctcaagccggcgcccgaa
tcccccttggacgcactgctgctggccgagctgatcgccgattccggcatcccgtccggg
gtggtgaacgtgctgccgggtccggccggggtcggcgaacggctggtacgccaccccggg
gtggacaaggtgtcgttcaccggctcgaccgccgccggccgcgcggtcgccgccgccgcg
gccgccggactcaaacgggtgagcctcgaactgggcggcaagtcggccgcggtggtgctg
tcggatgccgatccggcggccgtcgccaccgcggtgcgttcggccagcctgagcaacagc
ggacagatctgcaatgccctcacccgcatcctgatgccggccggccgggccgccgagttc
accgacgcgctggccgccgagatggaaagcctggtgatcggcgatcccaccgacgcggag
acccagatcggccccttggtggcgcggcggcagcaggaacgggttcgcggctacatcgag
gcgggctgcgccgagggcgcccggctggtcaccggcggccccggactccccgccggtgtc
gacagggggtggtacgtgcagcccaccctgttcgccgatgcggacaactccatgcgcatc
gcgcgcgaggagatcttcggcccggtgctgaccgtgatcccctaccccgacgaggatgcg
gccgtggcgatcgccaacgactccgactacgggttggccggctcggtgttcaccgccgac
accgaacgcgggctggcgatcgccgcacgcatccgcaccggcaccttcggggtcaaccag
ggctacaccatggacccgttcgccccgttcggcggtgtcaagggcagcggatacggccgc
gagctcggacccgagggcatcgacgcctacaccgacgtcaagtcgatctcggtcgccccg
gcttcgaccacctag

DBGET integrated database retrieval system