KEGG   Mycolicibacterium thermoresistibile: 4412656_04337Help
Entry
4412656_04337     CDS       T05542                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mthn  Mycolicibacterium thermoresistibile
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: SNW20476
LinkDB All DBs
Position
1:complement(4535226..4536281)
Genome map
AA seq 351 aa AA seqDB search
MGRVDLPVLPPLEPMLAKAQAEVPDEPGVWSYEPKWDGFRALVFRDGDEVMLQSRNGREL
GRYFPELVEALRDELADRCVLDGEVVVPREIDGRVRLDWESLSQRIHPAASRVAMLAEQT
PAHFIGFDALATGATSLLDEPFRVRRDALNEAVRSKQWCHVTRTTEDPELGAEWLQAFEG
AGLDGVIAKRLDGPYLPGKREMVKVKHVRDADCVAIGYRIHKSGEGVGSILLGLYTEDGE
LRMVGGAASFTARNRLRLLADLQPLRIGNELREGEPSRWNSAADKRWIPVRPEKVCEVVY
DQMEGNSVDGRRFRHAVRFVRWRPDRDPRSCTFAQLEVPLHYDLYDVLEQA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggacgggtggatctccccgtgctgccgccgctggaaccgatgctggccaaggcgcag
gccgaagtccccgacgaacccggcgtgtggtcgtacgaacccaaatgggacggcttccgg
gcgttggtgttccgggacggcgacgaggtgatgctgcagtcccgcaacggacgcgaactc
gggcgctacttcccggaactcgtcgaggcgttgcgcgacgaactggccgaccgctgcgtg
ctcgacggcgaggtggtggtgccgcgtgagatcgacggccgggtgcggctggactgggag
tcgctgagccaacgcatccacccggccgcgagccgggtcgccatgctcgccgagcagacc
ccggcgcacttcatcgggttcgatgccctggccaccggcgcgacatcactgctcgacgaa
ccgttccgggtgcgccgggacgcgctgaacgaggcggtgcggagcaagcagtggtgccat
gtcacgcgcaccaccgaggaccccgaactgggcgccgagtggttgcaagccttcgagggc
gccggcctcgacggggtgatcgccaaacggctcgacggaccgtatctgccgggcaaacgc
gagatggtgaaggtcaaacacgtccgcgacgccgactgtgtggcgatcggataccgcatc
cacaagagcggagagggagtggggtcgatcctgctcgggctgtacaccgaggacggggag
ctgcgcatggtcggcggcgcggcgtcgttcacggccaggaaccggctcagactgctcgct
gatctgcaaccgctgcgcatcgggaacgaactgcgcgagggcgagcccagcaggtggaac
tccgcggcggacaagcggtggatcccggtccgtccggagaaggtgtgcgaggtcgtctac
gaccagatggagggcaacagcgtcgacggtcggcggttccgccatgcggtgcggttcgtg
cggtggcgaccggaccgcgatccgcgcagctgcacgttcgctcagctcgaggtgccgttg
cactacgatctgtacgacgtgctggagcaggcctga

DBGET integrated database retrieval system