KEGG   Mycolicibacterium thermoresistibile: 4412656_04370Help
Entry
4412656_04370     CDS       T05542                                 

Gene name
echA8_30
Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mthn  Mycolicibacterium thermoresistibile
Pathway
mthn00071  Fatty acid degradation
mthn00280  Valine, leucine and isoleucine degradation
mthn00281  Geraniol degradation
mthn00310  Lysine degradation
mthn00360  Phenylalanine metabolism
mthn00362  Benzoate degradation
mthn00380  Tryptophan metabolism
mthn00410  beta-Alanine metabolism
mthn00627  Aminobenzoate degradation
mthn00640  Propanoate metabolism
mthn00650  Butanoate metabolism
mthn00903  Limonene and pinene degradation
mthn00930  Caprolactam degradation
mthn01100  Metabolic pathways
mthn01110  Biosynthesis of secondary metabolites
mthn01120  Microbial metabolism in diverse environments
mthn01130  Biosynthesis of antibiotics
mthn01212  Fatty acid metabolism
Module
mthn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mthn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4412656_04370 (echA8_30)
   00650 Butanoate metabolism
    4412656_04370 (echA8_30)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4412656_04370 (echA8_30)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4412656_04370 (echA8_30)
   00310 Lysine degradation
    4412656_04370 (echA8_30)
   00360 Phenylalanine metabolism
    4412656_04370 (echA8_30)
   00380 Tryptophan metabolism
    4412656_04370 (echA8_30)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4412656_04370 (echA8_30)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    4412656_04370 (echA8_30)
   00281 Geraniol degradation
    4412656_04370 (echA8_30)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    4412656_04370 (echA8_30)
   00627 Aminobenzoate degradation
    4412656_04370 (echA8_30)
   00930 Caprolactam degradation
    4412656_04370 (echA8_30)
Enzymes [BR:mthn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4412656_04370 (echA8_30)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: SNW20506
LinkDB All DBs
Position
1:4561016..4561840
Genome map
AA seq 274 aa AA seqDB search
MADTYESVTVDVDGHVARVTLIGPGKGNAMGPAFWRELPEVFTRLDEDQNVRAIVLTGSG
KNFSYGLDLPAMGDSLAGVMGPDASARSRAEFHATVQRMQAAINAVADCRTPTIASVHGW
CIGGGVDLISAVDIRYASADARFSVREVKLAIVADVGSLARLPLILNDGHLRELALTGKD
IDAGRAEKIGLVNDVFADAEASLEAAHRTAAEIAANPPLTVRGIKDVLDQQRIDRVSASL
RYVAAWNAAFLPSKDLTEGIAATFEKRAPNFTGE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggctgatacctacgagtccgtcacggtcgacgtcgacggacatgtggcccgcgtgacg
ttgatcggaccgggcaagggcaatgcgatgggtccggcgttctggcgggagctgccggag
gtgttcacccggttggacgaggatcagaacgtccgggcgatcgtgctcaccgggtccggc
aagaacttcagctacggcctcgacctgccggcgatgggcgattcgctcgcgggggtgatg
ggccccgacgcgtcggcgcgcagccgcgccgaattccacgccaccgtgcagcggatgcag
gcggcgatcaacgcggtggccgactgccgcaccccgaccatcgcctcggtgcacggctgg
tgcatcggcggcggggtcgacctgatctcggcggtcgacatccgctatgccagcgccgac
gccagattctcggtgcgtgaggtgaagctggcgatcgtggccgacgtgggcagcctggcc
cggctgccgctgatcctcaacgacgggcacctgcgggaactggcgttgacgggtaaggac
atcgacgccggccgcgccgagaagatcggcctggtcaacgacgtcttcgccgacgccgag
gcgtcgctggaggccgctcaccgcaccgccgcggagatcgccgccaatccgccgctgacc
gtccgcggcatcaaggatgtgctcgaccagcagcgcatcgaccgggtgtcggccagcctg
cgttacgtcgcggcgtggaacgcggcgttcctgccgtcgaaggatctgaccgagggcatc
gcggccacgttcgagaagcgggccccgaacttcaccggcgagtag

DBGET integrated database retrieval system