KEGG   Mycolicibacterium thermoresistibile: 4412656_04432Help
Entry
4412656_04432     CDS       T05542                                 

Gene name
sodA
Definition
(GenBank) [Mn]-superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mthn  Mycolicibacterium thermoresistibile
Brite
Enzymes [BR:mthn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     4412656_04432 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: SNW20566
LinkDB All DBs
Position
1:4635196..4635816
Genome map
AA seq 206 aa AA seqDB search
MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDALAKLEEARANGDHSAIF
LHEKNLAFHLGGHVNHTIWWKNLSPNGGDKPTGELAAAIDEHFGSFDKFRAQFTAAANGL
QGSGWAVLGYDTLGQRLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWEDVQNRFNAAVSKAQGLIF
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaatacaccttgcccgatctcgattgggactacggtgcgcttgaaccgcacatc
tcgggccagatcaacgagctgcaccacagcaagcaccacgccacctatgtgaagggcgcc
aacgacgcactggcgaagctggaggaggcccgcgccaacggcgatcactccgccatcttt
ctgcacgagaagaacctggctttccatctcggcggccacgtcaaccacaccatctggtgg
aagaacctctcccccaacgggggtgacaagcccaccggtgagctcgccgccgccatcgac
gagcacttcggctcgttcgacaagttccgcgcacagttcaccgcggcggccaacggcctg
cagggctcgggctgggcggtgctcggctacgacaccctcggccagcggctgctgaccttc
cagctctacgaccagcaggccaacgttccgctgggcatcatcccgctgctgcaggtcgac
atgtgggagcacgccttctacctgcagtacaagaacgtcaaggccgactacgtcaaggcg
ttctggaacgtcgtcaactgggaggacgtgcagaaccggttcaacgcagcggtcagcaag
gcccagggcctgatcttctga

DBGET integrated database retrieval system