KEGG   Methanosarcina thermophila TM-1: MSTHT_1931
Entry
MSTHT_1931        CDS       T03892                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mthr  Methanosarcina thermophila TM-1
Pathway
mthr00300  Lysine biosynthesis
mthr01100  Metabolic pathways
mthr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mthr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSTHT_1931
Enzymes [BR:mthr01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSTHT_1931
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N 3HCDH_N 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: AKB13689
UniProt: A0A0E3H990
LinkDB
Position
complement(2366652..2367431)
AA seq 259 aa
MALLTPDDLRDINKQLQEADSIVRRVTGLDIKGICKTLYGTSPNSEKIGIVPVTAGNGII
KNFSASLHAITQYFGFDSFVTDMSDVSGYYEAVRSGADIILMADDHTFLAHNLKNGKIAN
NQPSTGIIYAEIASRNQKTDSKDVLVVGLGKVGFPGAVHLVHKGFRVYGYDTDKTLLKRA
VSSLGIIPFDIESPKRFSTIFEATPCANTIPETLLSENCVLSTPGIPCAISEELRLKYNV
QLVMEPLGIGTASMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcactcttaaccccagacgatctgagagatattaacaaacaacttcaggaagctgat
tctattgtacggagagtaaccggacttgacataaaaggcatctgcaaaaccctctacggc
acctctccgaattctgaaaaaatcggtatcgtgcctgtaaccgcaggaaacggcataata
aaaaatttttcggcttccctgcatgcaattacgcagtacttcggatttgacagttttgtt
acggacatgtcagatgttagcggctattatgaagccgttcgaagcggagccgatattatc
ctgatggcagatgatcacacctttcttgcgcataacctgaaaaacggaaaaatagccaac
aaccagccctctacaggcataatctatgctgaaatcgcttccaggaatcagaaaaccgat
tcaaaggatgtactggttgtggggctcgggaaggtaggtttccccggagcagtacacctt
gtgcacaaaggtttcagggtatatgggtatgatactgataaaaccctcctgaagcgagcg
gtttcaagccttggaattattcctttcgacattgaaagcccaaaaaggttttccactatt
tttgaggcgaccccatgtgcaaacacgatccctgaaactttactctcagaaaattgtgtg
ctttccacccctggaattccctgtgcaatctcagaagagcttcgactgaaatacaatgta
caacttgtaatggagcccctgggaataggaactgcatcgatgttgtattctgtgctgtga

DBGET integrated database retrieval system