KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_05890Help
Entry
MRGA423_05890     CDS       T01994                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mti  Mycobacterium tuberculosis RGTB423
Pathway
mti03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mti00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    MRGA423_05890
Enzymes [BR:mti01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MRGA423_05890
DNA repair and recombination proteins [BR:mti03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MRGA423_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AFE12226
LinkDB All DBs
Structure
PDB: 

Position
1046898..1049180
Genome map
AA seq 760 aa AA seqDB search
MGSASEQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQ
PAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLAWIAQQAALVGGRVPQWRFVA
EPGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLADIGLVTFPVTSGSKGLHL
YTPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIA
PYSLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAPVADRLTR
YRRMRDASKTPEPIPTAKPVTGDGNTFVIQEHHARRPHYDFRLERDGVLVSWAVPKNLPD
NTSVNHLAIHTEDHPLEYATFEGAIPSGEYGAGKVIIWDSGTYDTEKFHDDPHTGEVIVN
LHGGRISGRYALIRTNGDRWLAHRLKNQKDQKVFEFDNLAPMLATHGTVAGLKASQWAFE
GKWDGYRLLVEADHGAVRLRSRSGRDVTAEYPQLRALAEDLADHHVVLDGEAVVLDSSGV
PSFSQMQNRGRDTRVEFWAFDLLYLDGRALLGTRYQDRRKLLETLANATSLTVPELLPGD
GAQAFACSRKHGWEGVIAKRRDSRYQPGRRCASWVKDKHWNTQEVVIGGWRAGEGGHSSG
VGSLLMGIPGPGGLQFAGRVGTGLSERELANLKEMLAPLHTDESPFDVPLPARDAKGITY
VKPALVAEVRYSEWTPEGRLRQSSWRGLRPDKKPSEVVRE
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggcgtcggagcaacgggtgacgctgaccaacgccgacaaggtgctctatccc
gccaccgggaccacaaagtccgatatcttcgactactacgccggtgttgccgaagtcatg
ctcggccacatcgcgggacggccggcgacgcgcaagcgctggcctaacggcgtcgaccaa
cccgcgttcttcgaaaagcagttggcgttgtcggcgccgccttggctgtcacgtgcaacg
gtggcgcaccggtccgggacgacgacctatccgatcatcgatagcgcaaccgggctggcc
tggatcgcccaacaggcggcgctggtggggggccgagtgccgcagtggcggtttgtcgcc
gagcccggatcaggtgagttaaatccgggcccggcaacgcgtttggtgttcgacctggac
ccgggcgaaggcgtgatgatggcccagctggccgaggtggcgcgcgcggttcgtgatctt
ctcgccgatatcgggttggtcaccttcccggtcaccagcggcagcaagggattgcatctg
tacacaccgctggatgagccggtgagcagcaggggagccacggtgttggccaagcgcgtc
gcgcagcgattggagcaggcgatgcccgcgttggtcacctcgaccatgaccaaaagcctg
cgggccgggaaggtgtttgtggactggagccagaacagcggctcgaagaccaccatcgcg
ccgtactcactacgtggccggacgcatccgaccgtcgcggcgccacgcacctgggcggag
ctcgacgaccccgcactgcgtcagctctcctacgacgaggtgctgacccggattgcccgc
gacggcgatctgctcgagcggctggatgccgacgctccggtagcggaccggttgacccga
taccgccgcatgcgcgacgcatcgaaaactcccgagccgattcccacggcgaaacccgtt
accggagacggcaatacgttcgtcatccaggagcatcacgcgcgtcggccgcactacgat
ttccggctggaacgcgacggcgtgctggtctcgtgggcggtaccgaaaaacctgcccgac
aacacatcggttaaccatctagcgatacacaccgaggaccacccgctggaatacgccacg
ttcgagggcgcgattcccagcggggagtacggcgccggcaaggtgatcatctgggactcc
ggcacttacgacaccgagaagttccacgatgacccgcacacgggggaggtcatcgtgaat
ctgcacggcggccggatctctgggcgttatgcgctgattcggaccaacggcgatcggtgg
ctggcgcaccgcctaaagaatcagaaagaccagaaggtgttcgagttcgacaatctggcc
ccaatgcttgccacgcacggcacggtggccggtctaaaggccagccagtgggcgttcgaa
ggcaagtgggacggctaccggttgctggttgaggctgaccacggcgccgtgcggctgcgg
tcccgcagcgggcgcgatgtcaccgccgagtatccgcaattgcgggcattggcggaggat
ctcgccgatcaccacgtggtgctggacggcgaggccgtcgtacttgactcctctggtgtg
cccagcttcagccagatgcagaatcggggccgcgacacccgtgtcgagttctgggcgttc
gacctgctctacctcgacggccgcgcgctgctaggcacccgctaccaagaccggcgtaag
ctgctcgaaaccctagctaacgcaaccagtctcaccgttcccgagctgctgcccggtgac
ggcgcccaagcgtttgcgtgctcgcgcaagcacggctgggagggcgtgatcgccaagagg
cgtgactcgcgctatcagccgggccggcgctgcgcgtcgtgggtcaaggacaagcactgg
aacacccaggaagtcgtcattggtggctggcgcgccggggaaggcgggcacagcagtggc
gtcgggtcgctgctcatgggcatccccggtccaggtgggctgcagttcgccgggcgggtc
ggtaccggcctcagcgaacgcgaactggccaacctcaaggagatgctggcgccgctgcat
accgacgagtcccccttcgacgtaccactgcccgcgcgtgacgccaagggcatcacatat
gtcaagccggcgctggttgcagaggtgcgctacagcgagtggactccggagggccggctg
cgtcaatcaagctggcgtgggctgcggccggacaagaaacccagtgaggtggtgcgcgaa
tga

DBGET integrated database retrieval system