KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_05975Help
Entry
MRGA423_05975     CDS       T01994                                 

Definition
(GenBank) hypothetical protein
Organism
mti  Mycobacterium tuberculosis RGTB423
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5336 GRP
Motif
Other DBs
NCBI-ProteinID: AFE12243
LinkDB All DBs
Position
1065911..1066822
Genome map
AA seq 303 aa AA seqDB search
MTYSPGNPGYPQAQPAGSYGGVTPSFAHADEGASKLPMYLNIAVAVLGLAAYFASFGPMF
TLSTELGGGDGAVSGDTGLPVGVALLAALLAGVALVPKAKSHVTVVAVLGVLGVFLMVSA
TFNKPSAYSTGWALWVVLAFIVFQAVAAVLALLVETGAITAPAPRPKFDPYGQYGRYGQY
GQYGVQPGGYYGQQGAQQAAGLQSPGPQQSPQPPGYGSQYGGYSSSPSQSGSGYTAQPPA
QPPAQSGSQQSHQGPSTPPTGFPSFSPPPPVSAGTGSQAGSAPVNYSNPSGGEQSSSPGG
APV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacctactcgccgggtaaccccggatacccgcaagcgcagcccgcaggctcctacgga
ggcgtcacaccctcgttcgcccacgccgatgagggtgcgagcaagctaccgatgtacctg
aacatcgcggtggcagtgctcggcctggctgcgtacttcgccagcttcggcccaatgttc
accctcagtaccgaactcggcggaggtgatggcgcagtgtccggtgacactgggctgccg
gtcggggtggctctgctggctgcgctgcttgccggggtggctctggtgcctaaggccaag
agccatgtgacggtagttgcggtgctcggggtactcggcgtatttctgatggtctcggcg
acgtttaacaagcccagcgcctattcgaccggttgggcattgtgggttgtgttggctttc
atcgtgttccaggcggttgcggcagtcctggcgctcttggtggagaccggcgctatcacc
gcgccggcgccgcggcccaagttcgacccgtatggacagtacgggcggtacgggcagtac
gggcagtacggggtgcagccgggtgggtactacggtcagcagggtgctcagcaggccgcg
ggactgcagtcgcccggcccgcagcagtctccgcagcctcccggatatgggtcgcagtac
ggcggctattcgtccagtccgagccaatcgggcagtggatacactgctcagcccccggcc
cagccgccggcgcagtccgggtcgcaacaatcgcaccagggcccatccacgccacctacc
ggctttccgagcttcagcccgccgccaccggtcagtgccgggacggggtcgcaggctggt
tcggctccagtcaactattcaaaccccagcgggggcgagcagtcgtcgtcccccgggggg
gcgccggtctag

DBGET integrated database retrieval system