KEGG   Massilia oculi: DIR46_20000Help
Entry
DIR46_20000       CDS       T05448                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mtim  Massilia oculi
Brite
KEGG Orthology (KO) [BR:mtim00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mtim01001]
    DIR46_20000
Enzymes [BR:mtim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DIR46_20000
Protein kinases [BR:mtim01001]
 Serine/threonine kinases: Other
  Bacterial family
   DIR46_20000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TPR_2 TPR_12 TPR_16 TPR_1 TPR_19 TPR_8 TPR_10 TPR_17 APH TPR_11 RIO1 TPR_9 Kdo Seadorna_VP7 TPR_20 HTH_9 Kinase-like
Motif
Other DBs
NCBI-ProteinID: AWL06492
UniProt: A0A2S2DM98
LinkDB All DBs
Position
complement(4429552..4431714)
Genome map
AA seq 720 aa AA seqDB search
MTSSPDLLATPSTERYRLGRLLGNGGFGDVHEAWDPALQRTVAIKRLKPDLVRDEPDNLL
QEARLAASLRHPAFIQIYALEDDGHSKSIVMELVGGQTLHQLLSTTKLSRDQILDIVCQL
ADAMAQAHAAGLIHGDLKPANLMIEPSGQLRIMDFGLARKIDPLATESGDVLQTQGTIAY
LAPEILNGKHPSTLSDIYAVGVLMYEMMHGERPFAHLHGLALAAAQVQSSCSQWIYAADA
DQDMVALVRAMCTPDPSARIPTMKAVTETARRLRGGASGAAKKPLLPVALRLSRFTWRRV
AYCALTASLLFCATAYLVTSKEVAPRWLQPISNATQMSDGMTALRYFDRDGSLEIAIDNF
SAILAREPKHAAASAGIALAYALRYAGDRSDESWLQRADASAQAALALDDQLALGYAAKA
YVRWQQGRNEESLQLSEQSLHLDPFNVFALNTRSGVLMRMQRYVEAERSIEDARRKHPTE
RLFVDRLGALRYNEGDYVGAEKAFRDSIRLQPDGVYSYSNLSITLVKQGREDEALRVLQQ
GLQVRPSGYLYNNLGTALFSRGDYLGAAKAFEHAVSSSKGNSIAYLRWANLADTLRWIPG
RERDSQQAYRKAAALIKPLLNNAPDDSTLASRMGLYAAKLGDKATASVLTKKAVDAKPTN
ADIRFRAAVTYEIIGHRENALVELSNAQQYGYPRKLIGTEPDLLALRSDPRFDLLRMERE
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacttcatcgcctgacttgcttgccacacccagtaccgagcgatatcgcctcggtagg
ctgcttggcaatggtggattcggcgatgtacatgaggcgtgggatccggcgctgcagcgc
actgttgccatcaagcgcctgaagcctgacctggtgcgtgacgagccggataatctgctg
caagaggcacgactggcggcatcgttgcggcatcctgccttcatccagatttacgcactc
gaagacgatggccatagcaagtcgatcgtgatggagctggttggagggcaaaccctgcat
cagctgctgtccacgacaaagctgtcgcgggatcagatactcgatatcgtttgccagttg
gcggatgcgatggcgcaagcgcatgcggcggggttgattcatggcgatttgaaaccggcg
aacttgatgatcgaaccgtcagggcagttgcggatcatggattttgggctggcgcgcaag
atcgatccgttggcgaccgagtcgggagatgtgctgcagacacagggcaccatcgcctat
ctggcgcctgaaattttgaatggcaagcatccgagtacgcttagcgatatttatgctgtc
ggcgtgttgatgtacgagatgatgcatggagagcggccgtttgcgcatttgcatggcttg
gcattggctgcagcacaggtgcagtcatcttgctcccagtggatctacgctgcggatgcc
gatcaagatatggttgcactagttcgcgcgatgtgcacgcctgatccgagcgcacggata
ccgacgatgaaagcggttacggagactgcgcgcaggctgaggggtggagctagcggcgcc
gcaaagaaacctttgctgcctgtagcgctccgactatcacgcttcacctggcgtcgggtt
gcctactgcgctttgaccgcctcattactattttgcgccacggcatatttagtaacgtcg
aaggaagtggcacctcggtggctacaaccaatatctaacgcgacgcagatgtcggatggc
atgacagcactgcgttattttgatcgcgatggcagtctggaaatcgctatcgacaatttt
agcgctatcctcgcaagagagccaaaacatgctgcggcgtcggcaggcatcgcattggct
tatgccttgcgttatgcaggagatcgtagtgatgaaagctggctacagcgcgctgatgct
agtgctcaggcagctctagcgctagacgatcaattggcacttggctacgctgccaaagca
tatgttcgctggcagcaaggacggaatgaagaaagtctgcaactctccgagcaaagcctg
cacctagatccattcaacgtctttgcacttaacacccgtagtggcgtactgatgcgtatg
cagcgctatgtggaagccgaacgcagtatcgaagacgcacgaaggaaacatccgacggaa
cgacttttcgttgatcgtctgggagcactccgttataacgagggggattatgtgggcgca
gaaaaagcctttcgtgacagtattcggctccaacccgacggagtttattcctactcgaat
ctcagtatcaccttggtaaaacagggccgcgaggatgaggcactccgggttttgcaacaa
ggcttgcaagttcgacctagcgggtatctttacaacaacctcggaactgcattatttagt
cgcggcgactatctcggcgccgcgaaagcattcgagcatgctgtatcgtcatccaaagga
aatagcatcgcctatttgcgttgggcaaatctggccgataccctacgttggattccaggc
cgtgaacgagactctcaacaagcctaccgcaaagcggcagcgctgataaagccactgttg
aacaatgctccggacgatagcaccttggcctcacgaatgggcttgtacgccgcaaagctg
ggggataaagcgaccgcatctgtattgaccaagaaagccgtagacgctaaacccaccaat
gcagatattcgctttcgggccgctgtcacttatgaaatcattggccaccgagagaatgct
cttgttgaactgagcaatgcacaacagtatggatatcccagaaaactcattgggactgaa
cccgatttattagcactgcggagcgatccgcggtttgatttacttcgaatggaaagggaa
tga

DBGET integrated database retrieval system