KEGG   Massilia oculi: DIR46_20310Help
Entry
DIR46_20310       CDS       T05448                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mtim  Massilia oculi
Brite
KEGG Orthology (KO) [BR:mtim00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DIR46_20310
Enzymes [BR:mtim01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DIR46_20310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like FAD_oxidored Thioredoxin_3 DAO FAD_binding_3 NAD_binding_8 AlaDh_PNT_C Thi4 Glutaredoxin K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AWL06548
UniProt: A0A2S2DMK5
LinkDB All DBs
Position
4507497..4509065
Genome map
AA seq 522 aa AA seqDB search
MLDATLKKQLQAYLEKVVQPIELVASLDDSPKSREMDELLNEIAALSDKITVRQEANERT
PSFAINRVGTDIGVRFAGIPLGHEFTSLALALLHVGGHTIKLEQSVIDQIAALDGDYVFE
TYISLSCHNCPEVVQALNTMSVINPRIKVVTIDGGVFKKEVEDKQILAVPMMFLNGQHFG
QGRTNVEEILSKIDVKGGERKAAELSQKDPFDVLIVGGGPAGAAAAIYAARKGIRTGVLA
DRFGGQVLDTLAIENFVSLKATDGPKFAVALEEHVKDYDVDIMNTQRASKLVGGSMIEVH
TESGAVLRSKTVIVATGARWREINVPGEKEYKNHGVAYCPHCDGPLFKGKRVSVIGGGNS
GVEAAIDLAGIVKEVTLIEYGNELRADAVLQRKLYSLPNVKVIKSAQTTEIHGDGKIVNG
LSYKDRTTGELHKLDLEGVFVQIGLVPNAEWLKGTIDLSAHGEIEVDARGHTSLPGVFAA
GDVTTVPFKQIVIAVGEGAKASLAAFDHLIRLPVEEEEQKAA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgcaaccctcaagaaacagttgcaagcctatctggaaaaagtggtgcagccg
attgagctggttgcatcgctggatgattcgccgaaatcgcgcgaaatggacgagctgctc
aacgagatcgcagccctgtccgacaagatcaccgtgcgccaggaagccaacgagcgcacc
ccgtcgttcgcgatcaaccgcgtcggcaccgatatcggcgtgcgtttcgccggcatcccg
ctgggccacgaattcacctcgctggcgctggccctgctgcacgtcggcggccacaccatc
aagctggaacaatccgtcatcgaccagatcgcagccctggacggcgactacgtcttcgag
acctacatctcgctgtcgtgccataactgcccggaagtcgtgcaggcactgaacacgatg
tcggtcatcaacccgcgcatcaaggtcgtgacgatcgatggcggcgtcttcaagaaggaa
gtggaagacaagcagatcctggccgtgccgatgatgttcctgaacggccagcatttcggc
cagggccgcaccaacgtcgaagagatcctgtcgaagatcgacgtcaagggcggtgagcgc
aaggctgccgaactgagccagaaagacccgttcgacgtgctgatcgtcggcggcggcccc
gccggcgcggcagccgcgatctacgccgcccgcaagggcatccgtaccggcgtgctggcc
gaccgcttcggcggccaggtgctggacaccctcgcgatcgagaacttcgtgtcgctcaag
gcgaccgacggtccgaagttcgccgtcgccctggaagaacacgtcaaggattacgacgtc
gacatcatgaacacccagcgcgccagcaagctggtgggcggcagcatgatcgaagtgcat
accgagagcggcgcggtgctcaggtcgaagaccgtgatcgtggcgaccggcgcccgctgg
cgcgagatcaacgtgccgggcgagaaagagtacaagaaccacggcgtggcgtactgcccg
cactgcgatggcccgctgttcaagggcaagcgcgtgtcggtgatcggcggcggcaactcc
ggtgtcgaagcggcgatcgacctggcgggcatcgtcaaggaagtgaccctgatcgaatac
ggcaatgagctgcgcgccgatgcggtcctgcaacgcaagctgtattcgctgccgaacgtc
aaggtgatcaagtcggcccagaccaccgagatccacggcgacggcaagatcgtcaacggc
ctgagctacaaggatcgcactaccggcgagctgcacaagctggacctggaaggcgtgttc
gtgcagatcggcctggtgccgaacgccgaatggctcaagggcacgatcgacctgtcggcg
cacggcgagatcgaagtcgatgcccgcggccacacttcgctgccgggcgtgttcgctgcc
ggcgacgtgaccacggtgccgttcaagcagatcgtgatcgccgtgggcgagggcgccaag
gcttcgctggccgcttttgaccacctgatccgcctgccggtggaagaggaagagcagaaa
gctgcttga

DBGET integrated database retrieval system