KEGG   Massilia oculi: DIR46_25790Help
Entry
DIR46_25790       CDS       T05448                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
mtim  Massilia oculi
Pathway
mtim00550  Peptidoglycan biosynthesis
mtim01100  Metabolic pathways
mtim01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mtim00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DIR46_25790
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    DIR46_25790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mtim01003]
    DIR46_25790
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mtim01011]
    DIR46_25790
Enzymes [BR:mtim01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     DIR46_25790
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DIR46_25790
Glycosyltransferases [BR:mtim01003]
 Polysaccharide
  Bacterial polysaccharide
   DIR46_25790
Peptidoglycan biosynthesis and degradation proteins [BR:mtim01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   DIR46_25790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase KA1
Motif
Other DBs
NCBI-ProteinID: AWL07502
UniProt: A0A2S2DQ36
LinkDB All DBs
Position
5768737..5771211
Genome map
AA seq 824 aa AA seqDB search
MDHDQNNENTDTADTAPTVQQRMKQVFRRLARRLLAGASTRAGALRTGARARLHGRPLPV
KLALVALWSMAAGLMAVLAWLLILIPFTPGIDDLEQVSRSRPSVILDAGGRPLGTFEKGL
QERVKLSQVSPHVVEALISTEDHRFYRHHGVDFKRVAGALWASVKGAPQGGSTITQQLAR
NMFPQEIGRARSVNRKMKELITAIKIENTYSKTQILEAYLNTVPFLYNAYGIEMAARTYF
DKPASRLDVLESATLVGMLKGTHYYNPVANPERSLARRNVVLGQMRKHGAFDDKRHAQLV
KRPMRLRFARLPDRSGKDDHFTHHVRKWLLDWADENDYNLQLDGLVVRTTLDPELQAAAE
RAVRRQADILQAIADVEWANPNLPRSTATATYTAIRPNIDPFSYYWITNARALDAFVRES
GAYRSAVEEGEEPAAALKRLKADRSFMHELKSAKSRLEAGFVAVDPASGAVRAWVGSRDF
ERDQYDHVAQAARQPGSTFKPFVYGAALERGIPPTQAYRDVVLEFKGDHGEVWKPTDMDG
NSGRSMPMRDGLVFSKNTITAQVSQEVGIGPIVRLAQGLGIRQSRLEAVPSLALGTSPVT
LFEMVSSYATIAALGEYRKPIFVRTIEDREGNVIADFGGGQPERAMSRESAEALIDMLRG
VVTRGTGNGVRSRFGIRSDLAAKTGTSQNNQDGWFIMMHPNLVAGAWVGFNDNRVTIRSS
YWGQGGHNAALVVGDFFRGAFDNGSLDAKATLPGWRPPEPRRYVVEEEPEEIFMDEAQDI
VPEGGPEEMPVAPPLEAIEPPIEPLEAAPTPSAPPTAVPTPSVL
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
gtggaccacgaccagaacaacgagaacacggacaccgcggacaccgcgccaaccgtgcag
caacgcatgaagcaggtcttccggcgcctcgcccgccgcctgctcgccggggcctccacc
cgggccggcgccctcaggaccggcgccagggcgcgcctgcacggccggccgctgccggtc
aagctggccctggtcgcgctctggagcatggccgcgggcctgatggcggtcctggcctgg
ctcctgatcctgatcccgttcacgcccggcatcgacgacctggaacaggtcagccgctcg
cgcccgtccgtgatcctggacgccggcggccggccgctcggcaccttcgagaaaggcctg
caggaacgcgtcaagctgtcgcaggtgtcgccgcacgtggtcgaggcgctgatctcgacc
gaggaccaccgcttctaccggcaccacggcgtcgacttcaagcgcgtcgccggcgcgctc
tgggccagcgtcaagggcgcgccgcagggcggctcgaccatcacccagcagctggcgcgc
aatatgttcccgcaagagatcggccgcgcccgcagcgtgaaccgcaagatgaaggaactg
atcacggcgatcaagatcgagaacacctacagcaagacccaaatcctggaagcctacctg
aacacggtgcctttcctgtacaacgcctatggcatcgaaatggcggcgcgcacctacttc
gacaagccggcatccaggctcgacgtgctggagtcggcgacgctggtcggcatgctcaag
ggcactcattactacaatccggtggccaacccggaacgctcgctggcgcgccgcaacgtg
gtgctgggccagatgcgcaagcacggcgccttcgacgacaagcgtcatgcgcaactggtc
aagcggccgatgcgcctgcgcttcgcgcgcctgcccgaccgcagcggcaaggacgaccat
ttcacccaccacgtgcgcaagtggctgctcgactgggccgacgagaacgactacaacctg
cagctcgacgggctggtggtgcgcaccacgctcgacccggaactgcaggcggcggccgag
cgcgcggtgcggcgccaggccgacatcctgcaggcgatcgccgacgtcgagtgggccaac
cccaacctgccccgctcgaccgccacggccacctatacggcgatacgcccgaacatcgat
cccttctcttactactggatcaccaatgcgcgcgcgctggatgccttcgtgcgcgagagc
ggcgcctaccgcagcgcggtcgaggagggcgaagagccggcggccgcgctcaagcgcctg
aaggccgaccgcagcttcatgcatgaactgaaaagcgccaagtcgcgcctggaggcgggc
ttcgtggcggtggacccggccagcggcgcggtcagggcctgggtcggcagccgcgacttc
gagcgcgaccagtacgaccacgtggcccaggccgcgcgccagccgggatcgaccttcaag
cccttcgtctatggcgcggcgctcgagcgcggcatcccgccaacccaggcctaccgcgac
gtggtgctcgaattcaagggcgaccacggcgaggtgtggaagccgaccgatatggacggc
aacagcggccgctcgatgccgatgcgcgacggcctggtgttttcgaagaacacgatcacc
gcccaggtgagccaggaagtgggcatcgggccgatcgtgcgcctggcccagggcctgggc
atccgccagagcaggctggaggcggtgccctcgctggccctgggcaccagcccggtcacc
ctgttcgagatggtgagcagctatgccaccatcgcggccctgggcgagtaccgcaagccg
atctttgtccgcaccatcgaggaccgcgaaggcaacgtgatcgccgatttcggcggcggc
cagcccgaacgcgcgatgtcgcgcgagtcggccgaagccctgatcgacatgctgcgcggc
gtcgtcacgcgcggcaccggcaacggcgtacgcagccgcttcggcatccgcagcgacctg
gcggccaagaccggcaccagccagaacaaccaggacggctggttcatcatgatgcacccg
aacctggtggccggggcctgggtcggcttcaacgacaaccgggtcaccatccgcagcagc
tactgggggcagggcgggcacaatgcggcgctggtggtgggcgacttcttccgcggcgct
ttcgataacggcagcctcgacgcgaaggccacgctgcccggatggcgcccgccggagccg
cggcgctacgtggtggaagaggagccagaagaaatcttcatggacgaagcacaggacatc
gtgccggaaggcggcccggaggagatgccggtggcgccgccgctagaggcaatcgagcct
ccgatcgaaccgcttgaggcggcgccgacgcctagcgcgccgccgactgccgtcccgacg
ccgtcggtgttgtag

DBGET integrated database retrieval system