KEGG   Mycobacterium tuberculosis Beijing/NITR203: J112_17830Help
Entry
J112_17830        CDS       T02616                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mtj  Mycobacterium tuberculosis Beijing/NITR203
Pathway
mtj00020  Citrate cycle (TCA cycle)
mtj00190  Oxidative phosphorylation
mtj00650  Butanoate metabolism
mtj01100  Metabolic pathways
mtj01110  Biosynthesis of secondary metabolites
mtj01120  Microbial metabolism in diverse environments
mtj01130  Biosynthesis of antibiotics
mtj01200  Carbon metabolism
Module
mtj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    J112_17830 (sdhA)
   00650 Butanoate metabolism
    J112_17830 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    J112_17830 (sdhA)
Enzymes [BR:mtj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     J112_17830 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     J112_17830 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO HI0933_like FAD_oxidored FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGJ69455
LinkDB All DBs
Position
3704638..3706410
Genome map
AA seq 590 aa AA seqDB search
MICQHRYDVVIVGAGGAGMRAAVEAGPRVRTAVLTKLYPTRSHTGAAQGGMCAALANVED
DNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKMGMPFNRTPEGRIDQRRFGGH
TRDHGKAPVRRACYAADRTGHMILQTLYQNCVKHDVEFFNEFYALDLALTQTPSGPVATG
VIAYELATGDIHVFHAKAVVIATGGSGRMYKTTSNAHTLTGDGIGIVFRKGLPLEDMEFH
QFHPTGLAGLGILISEAVRGEGGRLLNGEGERFMERYAPTIVDLAPRDIVARSMVLEVLE
GRGAGPLKDYVYIDVRHLGEEVLEAKLPDITEFARTYLGVDPVTELVPVYPTCHYLMGGI
PTTVTGQVLRDNTSVVPGLYAAGECACVSVHGANRLGTNSLLDINVFGRRAGIAAASYAQ
GHDFVDMPPNPEAMVVGWVSDILSEHGNERVADIRGALQQSMDNNAAVFRTEETLKQALT
DIHALKERYSRITVHDKGKRFNTDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDY
PNRDDVNYMRHTMAYKEIGADKEGPELRSDVRLDFKPVVQTRYEPKERKY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
ttgatctgccaacaccgatacgacgtggtgatcgtcggcgcgggcggtgccgggatgcgc
gccgcggtcgaggcgggtccgcgggtgcgtaccgcggtgctgaccaagctgtatcccacc
cgcagccacaccggcgcggcccagggcggcatgtgcgccgcgctggccaacgtcgaggac
gacaactgggagtggcacacgttcgacaccgtcaagggcggcgactatctcgccgaccag
gacgccgtggagatcatgtgcaaggaagccatcgacgcggtgctcgacctggagaagatg
gggatgccgttcaaccgcacccccgagggccgcatcgaccagcgccgcttcggcgggcac
acccgcgaccacggcaaggccccggtgcgccgggcctgctacgcggccgatcgcaccggc
cacatgattctgcagacgctgtatcagaactgcgtcaagcacgacgtcgagttcttcaac
gagttttacgcgctggatttggctttgactcaaacgccgtcgggcccggtggccaccggg
gtgatcgcctacgagctagcgaccggtgacatccatgtctttcacgccaaggccgtcgtg
atcgcgaccggcggctcgggccgcatgtataagaccacgtccaacgcacacaccctgacc
ggcgacggcatcggcatcgtgttccgcaagggacttcccttggaggacatggagtttcac
cagtttcaccctaccggcctggccggtctgggcatcttaatctccgaagcggtgcgcggc
gaaggcggccggctgctcaacggggaaggtgagcgtttcatggagcgctacgccccgacg
atcgtcgacctagcgccccgcgacatcgtcgcccgctcgatggtgctggaagtgctggag
ggacgcggcgccggaccgctcaaggactacgtctacatcgacgtccgccacctgggcgag
gaagtgctcgaggccaagctgcccgacatcaccgagttcgcccgcacctacctgggcgtg
gatccggtcaccgagctggtgccggtctacccgacgtgccactacctgatgggcggcatc
ccgaccacagtcaccgggcaggtgctgcgggacaacaccagcgttgtcccgggcctgtat
gcggccggcgagtgcgcgtgcgtgtcggtgcatggcgccaaccggctgggcaccaactcg
ctgttggatatcaacgtcttcggtcgtcgggccggcatcgccgccgccagttatgcgcag
ggtcacgactttgtcgacatgccgcccaacccggaggccatggtggtgggctgggtcagc
gacatcctgtccgaacacggaaacgagcgggtcgccgacattcgcggggcgctgcagcag
tcgatggacaacaacgccgcggtgttccgcaccgaggagaccctgaagcaggcgctcacc
gacatccacgcgctcaaggagcgctactcccgaatcacggtgcacgacaaggggaaacgc
ttcaacaccgacctgctggaagccatcgagctgggatttttactggagctggccgaggtc
acggtggtcggcgctttgaatcgcaaggagtcccgcggcggtcacgcccgcgaggactat
cccaaccgcgacgacgtcaactacatgcgacacaccatggcctacaaggaaattggggcc
gataaggagggccccgagctgcgcagcgatgtccgccttgatttcaaacccgtcgtgcag
acccgttacgaacccaaggaacggaagtactaa

DBGET integrated database retrieval system