KEGG   Mycobacterium tuberculosis Beijing/NITR203: J112_17835Help
Entry
J112_17835        CDS       T02616                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mtj  Mycobacterium tuberculosis Beijing/NITR203
Pathway
mtj00020  Citrate cycle (TCA cycle)
mtj00190  Oxidative phosphorylation
mtj00650  Butanoate metabolism
mtj01100  Metabolic pathways
mtj01110  Biosynthesis of secondary metabolites
mtj01120  Microbial metabolism in diverse environments
mtj01130  Biosynthesis of antibiotics
mtj01200  Carbon metabolism
Module
mtj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    J112_17835 (sdhB)
   00650 Butanoate metabolism
    J112_17835 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    J112_17835 (sdhB)
Enzymes [BR:mtj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     J112_17835 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     J112_17835 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_7 Fer4_15 Fer4 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AGJ69456
LinkDB All DBs
Position
3706410..3707201
Genome map
AA seq 263 aa AA seqDB search
MSVEPDVETLDPPLPPVPDGAVMVTVKIARFNPDDPDAFAATGGWQSFRVPCLPSDRLLN
LLIYIKGYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDLLPKKKGKSLTVTVE
PIRGLPVEKDLVVDMEPFFDAYRAIKPYLITSGNPPTRERIQSPTDRARYDDTTKCILCA
CCTTSCPVFWHEGSYFGPAAIVNAHRFIFDSRDEAAAERLDILNEVDGVWRCRTTFNCTE
SCPRGIEVTKAIQEVKRALMFTR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgagccggacgtcgaaactttggatccgcccctaccgccggtaccggacggc
gcggtgatggtgaccgtcaagatcgcccggttcaaccccgacgaccccgacgcgttcgcg
gccaccggcggctggcagagcttccgggtgccctgtttgcccagcgatcggctgctcaac
ctgctcatctacatcaagggctacctcgacggcacgctcaccttccggcgatcctgcgcc
catggggtgtgcggctctgatgccatgcgcatcaacggggtgaaccggctggcctgcaag
gtgctgatgcgtgacctgctgccgaagaagaagggcaaatcgttgaccgtcacggtcgag
ccgatccgcgggctgccggtggaaaaggacctggtggtcgacatggagccgttcttcgac
gcctaccgggcgatcaaaccgtacctgatcaccagcggcaacccgcccacccgcgaacgg
atccagagcccgaccgaccgcgcccgctacgacgacaccaccaagtgcatcctgtgcgcg
tgctgcaccaccagctgcccggtgttctggcacgagggcagctacttcggcccggcggcg
atcgtcaacgcgcaccgcttcatcttcgacagccgcgacgaggccgccgccgagcgcctc
gacatcctcaacgaggtcgacggggtgtggcgctgccgcaccacgttcaactgcaccgaa
tcctgcccacggggcattgaggtgaccaaggcgatccaggaggtcaagcgcgcgctgatg
ttcacccgctga

DBGET integrated database retrieval system