KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_02397Help
Entry
TBSG_02397        CDS       T01690                                 

Definition
(GenBank) anthranilate synthase component I trpE
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtk01100  Metabolic pathways
mtk01110  Biosynthesis of secondary metabolites
mtk01130  Biosynthesis of antibiotics
mtk01230  Biosynthesis of amino acids
mtk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mtk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TBSG_02397
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    TBSG_02397
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TBSG_02397
Enzymes [BR:mtk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     TBSG_02397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AEB04526
LinkDB All DBs
Structure
PDB: 

Position
complement(2609932..2611482)
Genome map
AA seq 516 aa AA seqDB search
MHADLAATTSREDFRLLAAEHRVVPVTRKVLADSETPLSAYRKLAANRPGTFLLESAENG
RSWSRWSFIGAGAPTALTVREGQAVWLGAVPKDAPTGGDPLRALQVTLELLATADRQSEP
GLPPLSGGMVGFFAYDMVRRLERLPERAVDDLCLPDMLLLLATDVAAVDHHEGTITLIAN
AVNWNGTDERVDWAYDDAVARLDVMTAALGQPLPSTVATFSRPEPRHRAQRTVEEYGAIV
EYLVDQIAAGEAFQVVPSQRFEMDTDVDPIDVYRILRVTNPSPYMYLLQVPNSDGAVDFS
IVGSSPEALVTVHEGWATTHPIAGTRWRGRTDDEDVLLEKELLADDKERAEHLMLVDLGR
NDLGRVCTPGTVRVEDYSHIERYSHVMHLVSTVTGKLGEGRTALDAVTACFPAGTLSGAP
KVRAMELIEEVEKTRRGLYGGVVGYLDFAGNADFAIAIRTALMRNGTAYVQAGGGVVADS
NGSYEYNEARNKARAVLNAIAAAETLAAPGANRSGC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgccgacctcgcagccaccacctcgcgtgaggatttccgcctcctggcggccgag
caccgggtggttccggtgactcgcaaggtcttggccgacagcgagacgccgctgtcggcc
taccgcaagctcgccgccaatcgcccgggtacgttcctgctggagtcggccgagaacggc
cggtcgtggtcgcgatggtcgtttatcggtgcgggggcgccaacggcgttgaccgtgcgt
gaggggcaagcggtatggctgggtgccgtgcccaaggacgctcccactggcggagacccg
ctgcgggcgctgcaggtgaccttggagctgctggctacggcggatcgtcagtccgagccg
ggtcttccgccgctgtcgggtggcatggtcggtttcttcgcctatgacatggtgcgacgg
ctggaacgattgccggaacgggccgtcgatgacctctgcctgccggacatgctgctgttg
ctggccaccgatgtggcggcggtcgatcaccacgagggcaccatcacgttgatcgccaac
gccgtgaactggaacggcaccgacgagcgggtcgactgggcctacgacgacgcggtcgct
cggctggacgtgatgaccgcagcgctcggccaaccactaccgtcaaccgtggccaccttc
agccgacccgagccgcgccaccgtgcgcaacgcaccgtcgaagaatatggtgcgatcgtc
gaatacttggtggatcagattgcagccggtgaagcgttccaggtggtgccctcgcagcgc
ttcgagatggacaccgatgtcgatcccatcgacgtgtaccgaattctgcgggtaaccaac
ccaagtccctacatgtatctactgcaggtgccgaatagtgatggtgcagtggacttttcg
attgttggatccagtccggaggcgctggtaacggtccacgaaggctgggcgacgacgcat
ccgatcgccggaacccggtggcgcggaaggacagacgacgaggacgtgcttctggaaaaa
gagctgctggcggacgacaaagaacgtgccgagcatctgatgctggtcgacctcggccga
aacgacctgggtcgggtctgcacgccgggcactgttcgggtcgaggattacagccacatc
gagcggtacagccacgtgatgcacctggtgtccacggtgaccgggaagctcggcgaaggg
cgcaccgcgctggacgcggtgaccgcctgctttccggccggcacgctgtcgggcgcgccg
aaggtgcgggcgatggagctgatcgaagaggtggagaagacacgccgcggcctttacggc
ggtgtcgtcggttaccttgacttcgccggcaacgctgacttcgccatcgccatccgcacc
gcgctgatgcgtaacggcacggcttatgtccaggcaggcggtggtgtggtggccgactcc
aacggatcctacgaatacaacgaggcgaggaacaaggctcgggctgtgctcaacgcgatc
gctgccgccgagacgctggccgctccgggcgcgaaccgcagtggctgctaa

DBGET integrated database retrieval system