KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03373Help
Entry
TBSG_03373        CDS       T01690                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase glpD2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00564  Glycerophospholipid metabolism
mtk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TBSG_03373
Enzymes [BR:mtk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TBSG_03373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N Pyr_redox HI0933_like AlaDh_PNT_C Thi4
Motif
Other DBs
NCBI-ProteinID: AEB05502
LinkDB All DBs
Position
complement(3682476..3684233)
Genome map
AA seq 585 aa AA seqDB search
MSNPIQAPDGGQGWPAAALGPAQRAVAWKRLGTEQFDVVVIGGGVVGSGCALDAATRGLK
VALVEARDLASGTSSRSSKMFHGGLRYLEQLEFGLVREALYERELSLTTLAPHLVKPLPF
LFPLTKRWWERPYIAAGIFLYDRLGGAKSVPAQRHFTRAGALRLSPGLKRSSLIGGIRYY
DTVVDDARHTMTVARTAAHYGAVVRCSTQVVALLREGDRVIGVGVRDSENGAVAEVRGHV
VVNATGVWTDEIQALSKQRGRFQVRASKGVHVVVPRDRIVSDVAMILRTEKSVMFVIPWG
SHWIIGTTDTDWNLDLAHPAATKADIDYILGTVNAVLATPLTHADIDGVYAGLRPLLAGE
SDDTSKLSREHAVAVPAAGLVAIAGGKYTTYRVMAADAIDAAVQFIPARVAPSITEKVSL
LGADGYFALVNQAEHVGALQGLHPYRVRHLLDRYGSLISDVLAMAASDPSLLSPITEAPG
YLKVEAAYAAAAEGALHLEDILARRMRISIEYPHRGVDCAREVAEVVAPVLGWTAADIDR
EVANYMARVEAEVLSQAQPDDVSADMLRASAPEARAEILEPVPLD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacccaatccaggcaccggacggcgggcaggggtggcccgccgcggcgctggga
cctgcacagcgcgcggtcgcctggaagcgactcggaaccgagcaattcgacgtcgtggtg
atcggcggcggagtagtgggctccggatgcgctttggatgctgccacccgtgggctcaag
gtggcgttggtcgaggcgcgggacttggcctccggcacgtcgagccgctcctcgaagatg
ttccacggcgggctgcgctacctcgagcaactggagttcgggctggtgcgtgaggcgctc
tatgaacgtgaactgtcgctgaccacgctggcaccgcatttggtcaagccgctgccgttt
ttgttcccgctgaccaaacgctggtgggagcgtccctacatcgccgcgggtatctttctt
tacgaccggctgggtggcgcgaaatcggttccggcgcaacggcattttactcgcgccggt
gcgctgcgactgagccccggcttgaagcgcagctcgctgatcggtggtatccgttactac
gacaccgtcgtcgacgacgcccggcacaccatgacggtcgcgcgcaccgcggcgcattac
ggcgcggttgtccgctgctccacccaggtagtggccttgttgcgagagggtgaccgggtg
atcggcgtgggcgtccgcgactccgagaacggcgcggttgccgaggttcgcggccacgtc
gtggtcaacgcgaccggggtctggaccgatgagattcaagcgttgtccaaacagcgcggg
cgcttccaggtgcgcgcatccaagggcgtgcatgtggtggtgccgcgggaccggattgtc
agtgacgtcgcgatgatcctgcgcacggagaagtcggtgatgtttgtcattccgtgggga
agtcactggatcatcggaaccaccgataccgactggaacctcgacctggcgcaccccgcg
gccaccaaggccgacatcgactacatcctgggcactgtcaacgccgtgttggcgaccccg
ttgacgcacgccgacattgacggagtgtacgccgggctgcggccgctgcttgccggggaa
agcgacgacacctccaagctgtcccgggaacacgccgtggctgtgccggcggcgggcctg
gtggccatcgccggtggcaagtacaccacctaccgagtaatggcggccgacgcgatcgac
gctgctgtgcagttcatccccgcccgcgttgcgccgtcgatcaccgagaaggtcagcctg
ctgggcgccgacggttactttgcactggtcaatcaggccgaacacgtcggcgcgctgcag
ggcctgcacccgtaccgggtgcgccatctgctggaccgctatggttcgctgatcagcgac
gttctagcgatggcggcctccgatcccagcctgttgagcccgataacggaggcaccgggc
tatttgaaggtggaagccgcttacgccgccgccgccgagggcgccctgcatctcgaggac
atcctggcccgtcggatgcggatttccatcgaatacccgcaccggggcgtcgactgcgcc
cgggaggtggccgaggtggtcgcgcccgtgctcgggtggaccgccgcagacatcgaccgc
gaggtcgcgaactatatggcgcgcgtggaggccgaggtgctctcccaggcccagcccgac
gacgtttcggcggacatgttgcgggccagcgcacccgaggcgcgtgccgagatcctcgag
ccggtgcctttggattga

DBGET integrated database retrieval system