KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03391Help
Entry
TBSG_03391        CDS       T01690                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur protein subunit sdhB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00020  Citrate cycle (TCA cycle)
mtk00190  Oxidative phosphorylation
mtk00650  Butanoate metabolism
mtk01100  Metabolic pathways
mtk01110  Biosynthesis of secondary metabolites
mtk01120  Microbial metabolism in diverse environments
mtk01130  Biosynthesis of antibiotics
mtk01200  Carbon metabolism
Module
mtk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mtk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TBSG_03391
   00650 Butanoate metabolism
    TBSG_03391
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TBSG_03391
Enzymes [BR:mtk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TBSG_03391
    1.3.5.4  fumarate reductase (quinol)
     TBSG_03391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_7 Fer4_15 Fer4 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AEB05520
LinkDB All DBs
Position
3701563..3702354
Genome map
AA seq 263 aa AA seqDB search
MSVEPDVETLDPPLPPVPDGAVMVTVKIARFNPDDPDAFAATGGWQSFRVPCLPSDRLLN
LLIYIKGYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDLLPKKKGKSLTVTVE
PIRGLPVEKDLVVDMEPFFDAYRAIKPYLITSGNPPTRERIQSPTDRARYDDTTKCILCA
CCTTSCPVFWHEGSYFGPAAIVNAHRFIFDSRDEAAAERLDILNEVDGVWRCRTTFNCTE
SCPRGIEVTKAIQEVKRALMFTR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgagccggacgtcgaaactttggatccgcccctaccgccggtaccggacggc
gcggtgatggtgaccgtcaagatcgcccggttcaaccccgacgaccccgacgcgttcgcg
gccaccggcggctggcagagcttccgggtgccctgtttgcccagcgatcggctgctcaac
ctgctcatctacatcaagggctacctcgacggcacgctcaccttccggcgatcctgcgcc
catggggtgtgcggctctgatgccatgcgcatcaacggggtgaaccggctggcctgcaag
gtgctgatgcgtgacctgctgccgaagaagaagggcaaatcgttgaccgtcacggtcgag
ccgatccgcgggctgccggtggaaaaggacctggtggtcgacatggagccgttcttcgac
gcctaccgggcgatcaaaccgtacctgatcaccagcggcaacccgcccacccgcgaacgg
atccagagcccgaccgaccgcgcccgctacgacgacaccaccaagtgcatcctgtgcgcg
tgctgcaccaccagctgcccggtgttctggcacgagggcagctacttcggcccggcggcg
atcgtcaacgcgcaccgcttcatcttcgacagccgcgacgaggccgccgccgagcgcctc
gacatcctcaacgaggtcgacggggtgtggcgctgccgcaccacgttcaactgcaccgaa
tcctgcccacggggcattgaggtgaccaaggcgatccaggaggtcaagcgcgcgctgatg
ttcacccgctga

DBGET integrated database retrieval system