KEGG   Mycobacterium tuberculosis KZN 4207: TBSG_03496Help
Entry
TBSG_03496        CDS       T01690                                 

Definition
(GenBank) alanine racemase alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mtk  Mycobacterium tuberculosis KZN 4207
Pathway
mtk00473  D-Alanine metabolism
mtk01100  Metabolic pathways
mtk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtk00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    TBSG_03496
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    TBSG_03496
Enzymes [BR:mtk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     TBSG_03496
Peptidoglycan biosynthesis and degradation proteins [BR:mtk01011]
 Precursor biosynthesis
  Racemase
   TBSG_03496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEB05625
LinkDB All DBs
Structure
PDB: 

Position
complement(3831440..3832666)
Genome map
AA seq 408 aa AA seqDB search
MKRFWENVGKPNDTTDGRGTTSLAMTPISQTPGLLAEAMVDLGAIEHNVRVLREHAGHAQ
LMAVVKADGYGHGATRVAQTALGAGAAELGVATVDEALALRADGITAPVLAWLHPPGIDF
GPALLADVQVAVSSLRQLDELLHAVRRTGRTATVTVKVDTGLNRNGVGPAQFPAMLTALR
QAMAEDAVRLRGLMSHMVYADKPDDSINDVQAQRFTAFLAQAREQGVRFEVAHLSNSSAT
MARPDLTFDLVRPGIAVYGLSPVPALGDMGLVPAMTVKCAVALVKSIRAGEGVSYGHTWI
APRDTNLALLPIGYADGVFRSLGGRLEVLINGRRCPGVGRICMDQFMVDLGPGPLDVAEG
DEAILFGPGIRGEPTAQDWADLVGTIHYEVVTSPRGRITRTYREAENR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggttctgggagaatgtcggaaagccaaacgacacgacagatgggcggggcacg
acttcgttggccatgacaccgatatcccagacacctggcctcctcgccgaggccatggtg
gatctgggcgctattgaacacaacgtgcgggtgctgcgtgagcacgccggccacgcgcag
ctgatggcggtggtcaaggccgacggctacggtcacggtgctacgcgcgtcgcccaaacc
gccctgggagccggtgcggccgaactcggcgtcgccaccgtcgacgaggcgctagcgctg
cgcgctgatggcattaccgcaccggtgctggcctggctgcatccgcccggcatcgacttc
gggcccgcgctgctggccgacgtgcaggtcgcggtgtcctcgctgcgccaactcgacgaa
ctgttgcacgcggtgcgccggaccggccggacggcgacggtgaccgtcaaggtggatacc
gggctgaaccgcaatggcgtgggaccggcacaattcccggccatgctgaccgcgttacgc
caagccatggccgaggacgccgtccggctgcgggggctgatgtcgcatatggtttacgcc
gacaagcctgacgattccatcaacgatgttcaggcccaacggtttaccgcctttctggcg
caggcccgcgaacaaggggtgcggttcgaggtggcgcatctatcgaactcatcagcaact
atggcgcgccccgacctgacgttcgacctggtgcggccgggcatcgcggtgtatgggcta
agcccggtacccgccctcggtgacatggggctggtgccggcgatgaccgtgaaatgtgct
gttgcgctggtgaaatcgattcgtgcgggggagggcgtgtcgtatgggcacacatggatc
gcgccacgcgacaccaatctggcgctgctgccgatcggttacgcagacggcgtgttccgg
tcgctgggcgggcggctggaggtgctgatcaacggcagacgatgccccggtgtggggcgg
atctgcatggaccagttcatggtcgacctgggccccgggccgcttgatgtggccgaaggc
gacgaggcgattttgttcgggccgggcatccggggtgagcccacggctcaggactgggcc
gatcttgtcggcaccatccactacgaagtggtcaccagcccgcgaggacgtatcaccagg
acctatcgcgaggctgaaaaccgttga

DBGET integrated database retrieval system