KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0208Help
Entry
CCDC5180_0208     CDS       T01992                                 

Definition
(GenBank) hypothetical protein
Organism
mtl  Mycobacterium tuberculosis CCDC5180
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_2
Motif
Other DBs
NCBI-ProteinID: AEJ49045
LinkDB All DBs
Position
266930..268084
Genome map
AA seq 384 aa AA seqDB search
MSALRSVLLLCWRDIGHPQGGGSEAYLQRIGAQLAASGIAVTLRTARYPGAPRHELVDGV
RISRAGGRYSVYLWALLAMAAARCGLGPLRRVRPDVVVDTQNGWPFVARLLYGRRSLVLV
HHCHREQWPVAGRMMGRLGWYVESMLSPRLHRRNQYVTVSLPSARDLIALGVDSERIAVV
RNGLDEAPSPTLSGPRAPTPRVVVLSRLVPHKQIEDALAAVAELQPRIPGLHLDIVGGGW
WRQRLVDHVHRLDIADAVTFHGHVDDVTKHHVLQSSWVHLLPSRKEGWGLAVIEAAQHGV
PTIGYRSSGGLADSIVDGVTGILVDDRAELVAWLEQLLSDSVLRDQLGAKAQARSGEFSW
RQSAEALRSVLEAVQASRFVSGVV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctctgcgctcggtgttgctgctgtgctggcgcgacatcgggcacccccagggg
ggcgggagcgaagcctatctgcaacgcatcggggctcagttggccgcatcgggcattgca
gtcacgttgcgcaccgctcgctatcccggtgcgccacggcatgaactggtcgacggggtg
cggatcagtcgtgccggcgggcgctactcggtgtatctatgggcgttgctggcgatggcc
gcagcccgatgtgggcttgggccgctgcgccgagtgcgcccggatgtggtcgtcgatacc
caaaacggctggccgtttgtggcccggctgttgtatggccggcggtcgctggtactggta
caccattgccaccgtgagcagtggccggtggccgggcggatgatgggtcggctcggctgg
tatgtcgagtcgatgttgtcgccacggctacaccggcgcaaccagtacgtgacggtgtcg
ctgccgtcggcgcgggatctgatcgccctcggtgtggacagcgagcggatcgctgtggtg
cgcaacggcctcgacgaggcgccgtcgccaacgttgtccggcccacgtgcgcccacgccg
cgtgtggtggtgctctcccggctggtgccgcacaagcagatcgaggacgcgttggcagcg
gtcgcggagctacagcctcggataccgggcctgcacctagacatcgtcggcggtggctgg
tggcggcagcgcctcgttgaccatgtgcaccggctcgacattgctgacgccgttaccttt
cacgggcatgtcgacgatgtgaccaaacaccatgtgctgcaaagctcctgggtgcacttg
ttgccctcacgtaaagagggatgggggctcgcggtcatcgaggcggcccagcacggcgtg
cccaccatcgggtacagatcctccggtggtttggcggactcgatcgtcgacggggtgacc
ggcatattggtcgacgaccgggccgaattggtggcttggctcgaacaactgctgtccgat
tcggtgctgcgtgaccaactcggcgccaaggcacaggcgcgtagcggtgagttctcctgg
cggcaaagcgccgaagcgctgcgcagcgtgttggaggcagtgcaggccagccgttttgtc
agcggcgtggtttga

DBGET integrated database retrieval system