KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_0749Help
Entry
CCDC5180_0749     CDS       T01992                                 

Definition
(GenBank) phosphate transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mtl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CCDC5180_0749
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtl02000]
    CCDC5180_0749
Enzymes [BR:mtl01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     CCDC5180_0749
Transporters [BR:mtl02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    CCDC5180_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_30 Rad17 AAA_16 AAA_33 RsgA_GTPase AAA_15 AAA_18 AAA_13 AAA_19 AAA_29 AAA_28 AAA PRK AAA_23
Motif
Other DBs
NCBI-ProteinID: AEJ49586
LinkDB All DBs
Position
908871..909647
Genome map
AA seq 258 aa AA seqDB search
MAKRLDLTDVNIYYGSFHAVADVSLAILPRSVTAFIGPSGCGKTTVLRTLNRMHEVIPGA
RVEGAVLLDDQDIYAPGIDPVGVRRAIGMVFQRPNPFPAMSIRNNVVAGLKLQGVRNRKV
LDDTAESSLRGANLWDEVKDRLDKPGGGLSGGQQQRLCIARAIAVQPDVLLMDEPCSSLD
PISTMAIEDLISELKQQYTIVIVTHNMQQAARVSDQTAFFNLEAVGKPGRLVEIASTEKI
FSNPNQKATEDYISGRFG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggccaagcggttggacctcacggacgtcaacatctactacgggtcatttcatgcggtc
gctgatgtgtcgctggcgattctgccccgcagcgtcacggcgttcatcggtccctcgggc
tgcggcaagacgacggtgctgcgcaccttgaaccggatgcatgaggtcatccccggagct
cgagtcgagggtgccgtactgctcgatgatcaagatatctacgcccccggtatcgacccg
gtcggtgtccgccgggcaatcgggatggtgtttcagcggccgaatccattccccgccatg
tcgattcgcaacaatgtggttgccggcctgaagctgcagggtgtgcgcaatcgcaaggtg
ctcgacgatacggccgaatcctcgctgcgcggcgcaaacctgtgggacgaggtcaaggat
cgactggataaacccggcggcggattgtctggggggcagcagcagcggttgtgcatcgca
cgggcaatcgccgtgcaacccgacgtgttgctgatggacgagccctgctcctcgctggac
ccaatctccaccatggccatcgaagacctgatcagcgagctcaagcagcagtacaccatc
gtcatcgtcacccataacatgcagcaggctgcccgggtgagtgatcagacggcattcttc
aacctggaagcggtgggaaagccggggcggctggtagagatcgccagcaccgagaaaatc
ttctccaacccgaaccagaaggccaccgaggactacatctccgggcgcttcggctag

DBGET integrated database retrieval system