KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_2312Help
Entry
CCDC5180_2312     CDS       T01992                                 

Definition
(GenBank) aroK, shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtl01100  Metabolic pathways
mtl01110  Biosynthesis of secondary metabolites
mtl01130  Biosynthesis of antibiotics
mtl01230  Biosynthesis of amino acids
Module
mtl_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCDC5180_2312
Enzymes [BR:mtl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CCDC5180_2312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 AAA_17 AAA_5 Mg_chelatase KTI12 Cytidylate_kin AAA AAA_22 ParA 6PF2K MMR_HSR1 CoaE Gly_kinase AAA_28 AAA_16 AAA_24
Motif
Other DBs
NCBI-ProteinID: AEJ51149
LinkDB All DBs
Structure
PDB: 

Position
complement(2850875..2851405)
Genome map
AA seq 176 aa AA seqDB search
MAPKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRI
EEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLL
AGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAAT
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaagcggttctcgtcggcctgccgggctccggcaagtccaccatcgggcgc
cggctggccaaggcgctcggggtcggcctgctcgacaccgacgtcgcgatcgagcagcgg
accggacgcagcatcgccgacatcttcgccaccgacggggagcaggagttccgacgtatc
gaggaggacgtggtgcgcgcggcactggccgaccacgacggtgtgctgtcgctcggcggc
ggcgcggtgaccagccccggtgtgcgcgcggcgctggccggccacaccgtcgtctacctg
gagatcagcgccgccgagggcgtgcgccgcaccggcggcaacaccgtgcgcccactgctg
gccggccccgaccgcgccgaaaaataccgcgcgctgatggccaagcgggcaccgctgtac
cggcgcgtcgcgaccatgcgagtggacaccaatcgccgcaaccccggggcggtggtccgc
catatcctgtcgcggctgcaggttcccagccccagcgaggcggccacatga

DBGET integrated database retrieval system