KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_2783Help
Entry
CCDC5180_2783     CDS       T01992                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mtl  Mycobacterium tuberculosis CCDC5180
Pathway
mtl03030  DNA replication
mtl03410  Base excision repair
mtl03420  Nucleotide excision repair
mtl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mtl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CCDC5180_2783
   03410 Base excision repair
    CCDC5180_2783
   03420 Nucleotide excision repair
    CCDC5180_2783
   03430 Mismatch repair
    CCDC5180_2783
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mtl03032]
    CCDC5180_2783
   03400 DNA repair and recombination proteins [BR:mtl03400]
    CCDC5180_2783
Enzymes [BR:mtl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CCDC5180_2783
    6.5.1.6  DNA ligase (ATP or NAD+)
     CCDC5180_2783
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CCDC5180_2783
DNA replication proteins [BR:mtl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CCDC5180_2783
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CCDC5180_2783
DNA repair and recombination proteins [BR:mtl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CCDC5180_2783
   NER (nucleotide excision repair)
    Other NER factors
     CCDC5180_2783
   MMR (mismatch exicision repair)
    Other MMR factors
     CCDC5180_2783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEJ51620
LinkDB All DBs
Position
3409434..3410942
Genome map
AA seq 502 aa AA seqDB search
MAITSMDVAATSSRLTKVARIAALLHRAAPDTQLVTIIVSWLSGELPQRHIGVGWAALRS
LPPPAPQPALTVTGVDATLSKIGTLSGKGSQAQRAALVAELFSAATEAEQTFLLRLLGGE
LRQGAKGGIMADAVAQAAGLPAATVQRAAMLGGDLAAAAAAGLSGAALDTFTLRVGRPIG
PMLAQTATSVHDALERHGGTTIFEAKLDGARVQIHRANDQVRIYTRSLDDVTARLPEVVE
ATLALPVRDLVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFFDILHR
DGTDLLEAPTTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMAKAPAA
RYLAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRRGKLSNIHLGARDPATGGFVMVGKTF
KGMTDAMLDWQTTRFHEIAVGPTDGYVVQLRPEQVVEVALDGVQRSSRYPGGLALRFARV
VRYRADKDPAEADTIDAVRALY
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggccatcacctcaatggacgtggccgccacctcgtcgcggctgaccaaggtcgcgcgc
atcgccgccctgttgcaccgcgccgcgccagacacacagctggtcacgatcatcgtgtcg
tggctctccggcgagctgccgcaacgccatatcggtgtcgggtgggcggcattgcggtcc
ctaccgccgcccgcgccgcaaccggcgttgaccgtcaccggtgtcgacgccaccctctct
aagatcggcactctatcgggcaaagggtctcaggcgcagcgcgcggcactcgttgcggaa
ttgttctccgccgcaaccgaagctgagcaaacctttttgttgcgactgctcggcggtgaa
ctgcgccagggcgcaaagggcgggatcatggccgatgcggtcgcccaggccgccgggctc
ccggccgcgacggtccaacgcgccgcgatgctaggcggcgacctggcggcagcggcggcg
gccggcctgtccggcgcggcgctggacaccttcaccctgcgagtgggccgaccgataggc
ccgatgctggcacagaccgcgaccagcgtccatgatgcactcgaacgtcacggcggcaca
accattttcgaggctaaactagacggcgcgcgagtgcagatccaccgggcaaacgaccag
gtcaggatctacacccgaagcctggacgacgtcactgcccggctgcccgaggtggtggag
gcaacactggcactgccggtccgggatctagtggccgacggcgaggcgatcgcgctgtgc
ccggacaaccggccgcagcgtttccaggtcaccgcatcacggttcggccgatcggtcgat
gttgcggctgcccgcgcgacgcagccactttcggtgttcttcttcgacatcctgcatcgg
gatggtaccgacttgctcgaagcgccgaccaccgagcggctggccgccctggacgcactg
gtgccggctcggcaccgcgtggaccggctgatcacgtccgatccaacggacgcggccaac
ttcctggatgcgacgctggccgccggccacgagggggtgatggccaaggcaccggccgct
cgttaccttgcgggtcgccgcggagcgggctggctgaaggtcaagccggtgcacacactc
gacttggtggtgctcgcggtggaatggggctcgggacgccggcgcggcaagctctccaat
attcacctgggcgcacgcgatccggctaccggtggattcgtgatggtgggcaagaccttc
aaaggaatgaccgacgccatgctggactggcagaccaccaggtttcacgagatcgcggtg
ggtccgacagacggctacgtcgtccaacttaggcccgagcaggtggtcgaggtagccctc
gacggcgtgcaaaggtcgtcgcgctacccgggcgggctggcattgcggtttgcccgcgtg
gtgcgctaccgcgccgacaaggacccggccgaggccgacaccatcgatgccgtgcgcgcg
ctctactga

DBGET integrated database retrieval system