KEGG   Mycobacterium tuberculosis CCDC5180: CCDC5180_3414Help
Entry
CCDC5180_3414     CDS       T01992                                 

Definition
(GenBank) ATP-dependent DNA ligase ligC
Organism
mtl  Mycobacterium tuberculosis CCDC5180
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEJ52251
LinkDB All DBs
Position
4176202..4177278
Genome map
AA seq 358 aa AA seqDB search
MQLPVMPPVSPMLAKSVTAIPPDASYEPKWDGFRSICFRDGDQVELGSRNERPMTRYFPE
LVAAIRAELPHRCVIDGEIIIATDHGLDFEALQQRIHPAESRVRMLADRTPASFIAFDLL
ALGDDDYTGRPFSERRAALVDAVTGSGADADLSIHVTPATTDMATAQRWFSEFEGAGLDG
VIAKPPHITYQPDKRVMFKIKHLRTADCVVAGYRVHKSGSDAIGSLLLGLYQEDGQLASV
GVIGAFPMAERRRLLTELQPLVTSFDDHPWNWAAHVAGQRTPRKNEFSRWNVGKDLSFVP
LRPERVVEVRYDHMEGARFRHTAQFNRWRPDRDPRSCSYAQLERPLTVSLSDIVPGLR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcagttacccgtcatgccgccggtgtcgccgatgctggccaaatcggtcaccgcaatc
ccgccggacgcgtcgtatgaacccaaatgggacggattccgctccatctgctttcgcgac
ggtgatcaggtcgaactgggtagccgcaacgagcggccgatgacccgctacttccccgag
ctggtcgccgcgatcagggccgagctgccgcatcgctgtgtgatcgacggggagatcatc
atcgccaccgaccacggcttggacttcgaggcgctgcaacagcgcatccatcctgccgag
tcgagggtgcgaatgcttgccgaccgcacaccagcctccttcatcgcattcgacctgctg
gccctcggcgacgacgactacaccgggcgaccgttcagcgaaagacgagccgctctggtc
gatgccgtaactggttcgggggccgacgctgacctgtcgatccacgtcaccccggcaacc
accgacatggcgaccgcacaacgatggttctccgagttcgagggggccggtctagacggt
gtcatcgccaaaccgccgcacatcacctatcaaccggacaaacgcgttatgttcaagatc
aaacacctgcggaccgccgattgcgtggtcgccggctaccgggtgcacaagtccggcagt
gacgcgatcggctcactgctgctagggctttaccaggaggacggccaactcgcgtcggtc
ggcgtgatcggcgcgttccccatggccgaacgacgccggctattaaccgagctgcagccg
ctggtcaccagcttcgacgaccacccatggaactgggccgcccacgttgccggccagcgc
accccacgtaagaacgagttctcccgctggaatgtcggcaaagacctgtcgttcgtgccg
ctgcgacccgagcgggtggtcgaggtccgctacgaccacatggaaggcgcgcggttccgc
cacaccgcacagttcaaccggtggcgccccgaccgcgacccacgctcatgcagctatgcc
cagctcgaacgcccgctcaccgtcagcctctccgacattgtgccgggcctacgctaa

DBGET integrated database retrieval system