KEGG   Thermothelomyces thermophilus: MYCTH_112802Help
Entry
MYCTH_112802      CDS       T02231                                 

Definition
(RefSeq) Crotonase-like protein
  KO
K22150  mevalonyl-CoA hydratase
Organism
mtm  Thermothelomyces thermophilus
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99988 Secondary metabolism
    MYCTH_112802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 11505387
NCBI-ProteinID: XP_003660949
JGI: 112802
UniProt: G2PZL8
LinkDB All DBs
Position
1:join(10634403..10634631,10634786..10635390)
Genome map
AA seq 277 aa AA seqDB search
MSWKRETVRFRHFYVSYPAEHIIQVTINRPDKLNCIDKATSREIAQVWEELDRDETLWVG
IITGAGRAFCTGADLHEWNDMNKAGVVNDMAAPGLAGLPRRDGKKPIIAAVNGICMGGGF
EMVANCDLVVAASSAVFSLPEVKRGIVPVAGCLPRLTRTLGLQRTMDLVLTGRTVDAKTL
YEWGLVTQVVDAAGADGDKLVVRAALEVAQAMCRNSPDALIVGRTGVRMAWEEGSVEKAV
SALEREWYPRLVQGANFREGIQAFVEKRSPKWRDSKL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggaaaagggagaccgtccgattccgacacttttatgtgtcctatccggcggaa
cacatcatccaggtcaccatcaaccggcccgacaagctcaactgcatcgacaaggcgacc
agccgcgagatcgcacaggtctgggaagaactcgaccgcgatgagacattgtgggtgggc
atcatcacgggcgccgggcgggcgttttgcaccggggcggatctccacgagtggaacgac
atgaacaaggcgggcgtggtcaacgacatggctgcgccggggctcgcgggactcccccgg
cgcgacggcaagaagcccatcattgcggccgtcaatggcatctgcatgggcggggggttc
gagatggtggccaattgcgacctggtggtggccgcgtcgtcggccgtcttctccctgccc
gaggtcaagcgaggcatcgtgccggtggcggggtgtctgccgcgcttgactcgcacgctg
gggttgcagcgcaccatggacctcgtgctaacgggccggacggtcgacgccaagacgctc
tacgagtgggggctcgtgacgcaggtggtggatgccgccggcgccgacggtgacaagctt
gttgtgcgggctgccctcgaggttgcgcaagccatgtgccgaaacagcccggatgcgctc
attgtcgggcggacgggggtgcgcatggcctgggaggagggcagtgtggagaaggcggtg
tcggccttggagcgggaatggtatccacggctggtgcagggcgccaacttccgcgagggc
atccaggcgtttgtggagaagaggagtcccaaatggcgggattctaagctgtga

DBGET integrated database retrieval system