KEGG   Thermothelomyces thermophila: MYCTH_2086155Help
Entry
MYCTH_2086155     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
Organism
mtm  Thermothelomyces thermophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_11 NAD_binding_2 SET Pre-SET 3HCDH_N F420_oxidored ApbA Pneumo_phosprot
Motif
Other DBs
NCBI-GeneID: 11505914
NCBI-ProteinID: XP_003660308
JGI: 2086155
UniProt: G2Q230
LinkDB All DBs
Position
1:join(8109505..8110824,8111367..8111438,8111496..8112455)
Genome map
AA seq 783 aa AA seqDB search
MAEPKPPIAFIGLGAMGFGMATHLVKQGYPVTGFDVWAPTLERFAAAGGLTASTPSAAVA
DKPFCVCMVATAQQAQSVLIDGPDAAVHALPKGAALLLCSTVPCDYVQSLDRQLRSLGRG
DILLVDSPVSGGAARAADGTLSIMAGMSDAALDKARPLLAEMADPAKLYIVQGGVGAGSN
MKMVHQVLAACHILASSEAVGFAARLGLDLAQTQKAVLGSDAWNWMFEHRTPRMLTQFQP
VASAVNIIVKDTKIITAEAKRSGFKVPMTGRAEEGYQQAVDKGYGQDDDSSLLRLYTGAG
SGETGESSAEADEEKLALVLDLLRGINLCAAGESLAFASFVGLDLDQVLDLCVNAAGSST
MLKQYGPQFITALRQGVDSRSSKAAEGELSLDAVAERLQRVVEEAERVKVPLFLGSRALD
VVREALKLGTSPLSVNAVVNRGRVPTANMEKSIRPHFFKHGLPESDPEEEKNCHWCQIRS
FATHKTIPITIVNDEDDEVLNPNFRFIDHSVIADDVPVAEDSFRTGCDCADDEDCMYNTC
QCLDEMAPDSDEDENDGSATRPRRKRFAYYSSGPKAGLLRSRILMSREPIYECHEGCSCS
LNCPNRVVERGRTVPLQIFRTPDRGWGVRCPVDIKEGQFVDKYLGEIISSREADRRRAEA
TVSRRKDVYLFALDKFSDPNSLDPLLAAPPLEVDGEWMSGPTRFINHSCDPNMRIFARVG
DHADKHIHDLALFAIRDIPAGEELTFDYVDGLEDMDNDAHDPSKIKDMTVCKCGTKRCRG
FLW
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcctaaacctcccattgccttcatcggcctcggcgccatgggcttcggcatg
gccacccacctggtcaagcagggctacccggtgacgggcttcgacgtctgggcgcccacc
ctcgagcgcttcgcggccgcgggcgggctcacggccagcacgccctcggctgccgtcgcc
gacaagcccttctgcgtctgcatggtggccacggcgcagcaggcccagtcggtgctcatc
gacgggcccgacgcggccgtccacgccctccccaagggtgccgccctgctcctctgctcc
acggtcccctgcgactacgtgcagtcgctcgaccggcagctgcgcagcctcgggcgcggc
gacatcctcctcgtggacagccccgtgtcgggcggcgcggcgcgggcggctgacggcacc
ctgtccatcatggcgggcatgtcggacgcggcgctagacaaggcgcgcccgctgctggcc
gagatggcggacccggctaagctgtacattgtgcagggcggcgtcggcgccgggagcaac
atgaagatggtgcatcaggtgctggcggcgtgccacatcctcgcctcgagcgaggccgtg
gggttcgcggcgcggctgggcctggacctggcccagacgcagaaggcggtgctcggatcg
gacgcgtggaactggatgtttgagcaccgcacgccgcggatgctgacgcagttccagccc
gtcgccagcgccgtcaacatcatcgtcaaggacaccaagatcattacggcagaggcgaag
aggagcggcttcaaggtgccgatgacggggagggccgaggaaggttaccagcaggccgtc
gacaagggctacgggcaggacgacgatagcagcctgctgaggctgtacaccggggcaggg
agcggcgagaccggagagagttcggcagaggcggacgaggagaagctggcattggtgctc
gacttgcttagggggatcaacctgtgcgcggctggagagtctctggcgtttgctagcttc
gtgggcttggatctcgaccaggtgctcgatctgtgcgtaaatgcggccggatcaagcacc
atgttgaagcagtacggtcctcagttcatcaccgctctccgccagggcgtcgactccagg
agctcaaaggctgccgagggagagctgagcctcgacgccgtcgccgagaggctgcagagg
gttgtagaggaggctgagcgggtcaaggtgccgctgttcttgggatcgcgggcgttggac
gtcgttcgcgaagccctgaagctcggaacatcgccgctatctgtcaatgcggtggtgaat
cgagggcgggtaccgaccgccaatatggagaagagtattcggcctcacttcttcaagcac
gggctcccagagtcagacccagaggaggaaaagaactgccactggtgccagatccgctcc
tttgctactcacaaaaccataccaattacaatagtcaacgacgaagacgacgaggtactg
aaccccaacttccgcttcatcgaccattctgtcattgccgacgatgtgccggtcgccgag
gactcctttcggaccggctgtgactgtgccgacgacgaggactgtatgtacaacacgtgc
cagtgcctcgacgagatggcgcccgacagcgacgaggacgagaacgacggctccgctacc
cggccgcggcggaagcggtttgcgtactactcgagcggacccaaggccggcttgctgagg
agtaggatcctcatgagccgcgaacccatctatgaatgccacgaaggctgcagctgctcg
ctcaattgtccgaatcgggtcgtggagcgaggcaggacggtgccgctgcagattttccgg
accccggatcggggctggggcgtcagatgtcccgtcgacatcaaggaaggccagttcgtc
gacaagtacctgggcgagatcatttcgagccgggaggcggacaggcggcgggcggaagcg
accgtctcccgccgcaaggacgtgtacctcttcgcgctcgacaagttctcggacccgaac
tcgctcgaccccttgctagcagcgccgccgctcgaggtggacggggagtggatgagcggc
cctacacggtttatcaaccacagctgcgatccgaacatgcgcatctttgcgcgcgtcggc
gaccacgctgacaagcacatccacgacctggctctgtttgcgattcgggatatccccgcg
ggagaggaactgacatttgactatgtcgacggcttggaggatatggacaacgatgcacac
gacccgtccaagatcaaggacatgacggtctgcaagtgcgggaccaagcggtgccgaggc
ttcctgtggtga

DBGET integrated database retrieval system