KEGG   Thermothelomyces thermophila: MYCTH_2087807Help
Entry
MYCTH_2087807     CDS       T02231                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00052  Galactose metabolism
mtm00500  Starch and sucrose metabolism
mtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MYCTH_2087807
   00500 Starch and sucrose metabolism
    MYCTH_2087807
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MYCTH_2087807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Rotavirus_VP7
Motif
Other DBs
NCBI-GeneID: 11512968
NCBI-ProteinID: XP_003658875
JGI: 2087807
UniProt: G2Q431
LinkDB All DBs
Position
1:join(2289771..2290434,2290496..2290977,2291041..2291266,2291313..2291404,2291485..2291514,2291566..2292807,2292926..2293171)
Genome map
AA seq 993 aa AA seqDB search
MALLASTSLLLAGLYLRTTSSVQISETPSQAAGHPPVFTLPPSADRGKNILPNIKDPKAI
DPQTVCPGYKASNLQDTKDGFTADLDLAGPACNVYGTDVEHLALSVEFQGDDRVHVEIRP
RYITPGNETWFLLPEELVPRPSARQAYTPGPNDLTVSWSNDPSFSFTVKRGAIGDTLFST
EGKRLVYEDQFIEFISTLPEDYNLYGLGEVIHGFRLGNNLTRTLFAADVADTIDANIYGS
HPVYLDTRYFTVDESGKLTYVANAKDMAAKYVSYTHGVFLRNAHAQEILLQSSGITWRTT
GGSIDLYFYSGPKAEDVIRSYQQSTTGLPAMQRYWTLGFHQCRWGYDSWAVLQEVVDNFA
KFEIPVETVWCESHSSAPRMGRNDPVRFGYEEGARFLAQLHANHQHYVPIVDSAIYAPNP
ENPGDAYPPYDRGVEANAFMMNPDGSIYYGAVWPGYTVFPDWVGAVLNGSGAIDWWIDEL
SRWSEKVAFDGLWIDMSEVASFCVGSCGTGNLTLNPVHPPFGLPGEAGNLVLQYPEGFEL
TNSSEAVSASSALSTQEAASPTTASPTSSFYRTTPTPGVRNVDWPPYAINNIHGDLAVHA
VSPNATHHGGYLEYDFHNMFGHQILNATYRALLKIHEGKRPFIIGRSTFAGSGKWAGHWG
GDNAALWAYMYFSIPQALSFSLFGVPMFGVDTCGFGGNSNYELCSRWMQLSAFFPFYRNH
NILGAIPQEPYVWASVIDATKTAMRIRYALLPYLYTLMARASLEGSTVMRALAWEFPDEP
WLADADRQFMLGRAIMVTPCLEQGASTVRGVFPGVGDGGKKTVWYDWYTGKAVTDEIKPG
QNVTIEAPLGHIPVYLRGGSVVPVQGPGMTTTESRRNPWGLIVALDREGFAEGELYLDDG
ESLEPAAVTWVQFTATNTSITAVPQGDYVDNNTFGNATVMGLAKGPVRMWLNRRVLDHAN
WQYDQDRAVLLLYGLNHLFPQGAWTDKWEINWE
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcttgcctcgacatctctccttctcgctgggctctatctgcgcacgacttcg
agtgttcaaatctctgaaacacctagccaagccgctggtcatcctcccgtgttcacactc
cccccttcggctgaccggggcaaaaacatcctccccaacatcaaggaccccaaggccatc
gaccctcagacagtatgtccgggctacaaggcatccaacctgcaagacaccaaggacggc
ttcaccgcggatcttgaccttgccggcccggcatgcaatgtttatggaactgacgtcgag
catttggccttgtctgtcgagttccagggcgatgatcgggttcacgtcgaaatccggccg
cgttacattacccctgggaatgaaacttggtttcttcttccggaggagctggtcccaagg
ccgtcggcgaggcaggcgtatactcctggcccaaacgacctgaccgtttcatggtctaac
gatccaagcttctcctttaccgtaaagcgtggggcaatcggcgacaccctcttttccacc
gaaggaaagagactcgtatacgaggaccagttcattgagttcatctctacactccccgaa
gactacaacctttatggtctcggcgaggtcattcacggattccgcctgggaaacaatctc
actaggactcttttcgccgccgacgttgctgacacaattgatgccaacatctacggtagc
cacccggtctaccttgacacgagatacttcacagttgacgagtcaggcaagcttacttat
gtcgccaatgcaaaggacatggctgcgaagtatgtctcgtatacgcatggcgtattcctc
cggaacgcccatgcccaggagattcttttgcaatcgtccggcatcacatggaggacgacg
ggggggagcatcgacctgtacttctatagtggcccaaaggcagaggacgtgataaggtcg
taccagcagtcgacaaccggactgccagctatgcagcggtactggacgcttggtttccat
cagtgtcgctggggttatgacagctgggcggtgctacaggaggtggtcgacaactttgcc
aagtttgagattcccgtggaaaccgtctggtgtgagtctcactcgtctgctccaagaatg
ggaagaaacgaccccgtgcggttcggctacgaggaaggggctcggttcctggcccagctt
cacgcaaatcaccaacactacgttcccatagtggactccgccatatacgcccctaatccc
gagaatcccggagatgcgtatcctccatatgatcgcggagttgaagcgaacgcattcatg
atgaatcccgatgggtccatctactacggcgccgtgtggcccggctatactgtattccct
gactgggtgggcgctgttctgaacggcagtggcgctattgactggtggatcgacgagctt
tcccggtggtctgagaaggttgcttttgatggattatggatcgacatgtcggaagttgcc
tccttttgtgttggcagctgcggcaccggtaacttgacgctgaacccggtccacccacca
ttcggacttccgggagaggctggaaatcttgtcttgcaataccctgaaggcttcgagctc
accaattcatcggaagctgtttcggcgtcgtctgctctcagtacgcaagaggctgcttcc
ccgacgacggcgagcccgacgtcttccttttaccgcaccacgcctactccgggagtgcgc
aacgtggattggccgccctatgccatcaacaacatccacggcgacttggcggtccatgct
gtcagcccaaacgctacacatcatggcggttacctcgagtacgactttcacaacatgttc
ggacaccagattctcaacgccacctatcgtgccctgctcaaaatacacgagggaaagcgg
ccctttatcatagggcgcagcaccttcgccgggtctggcaaatgggccgggcactgggga
ggcgacaacgcggcgctgtgggcatacatgtactttagcatcccacaggcgctgtccttc
tcgctctttggcgtgcccatgtttggtgtcgacacgtgcgggttcggcggcaacagcaat
tacgaactgtgctcccgctggatgcagctcagcgccttcttccccttctaccgcaaccat
aacatcctgggcgctatcccgcaggaaccctatgtctgggccagcgtcatcgacgccaca
aaaaccgccatgcgcatccgttacgccttgctgccgtacctgtacacgctcatggctcgc
gccagcctcgaggggagcaccgtcatgcgcgcgctggcgtgggagttccccgacgagccg
tggctggccgacgccgatcggcagttcatgctcggcagagccatcatggtgactccctgc
ctggaacagggcgccagcaccgtgaggggcgtatttcccggcgtcggagacggcggcaag
aagaccgtctggtacgactggtacacggggaaggcggtaacggacgagatcaaaccggga
cagaacgtcaccatcgaggcgccacttggtcacatccctgtctacttgcgcggtggcagt
gtggttcctgttcagggacccgggatgacgacgacggagagccggagaaacccgtggggt
ctgattgtggcgcttgatcgggagggtttcgcggagggagagctttatcttgacgatggt
gagagcttagagccggcggctgtgacttgggtacaattcactgccacaaatacatccatc
acagccgttcctcaaggcgactacgtcgacaacaacacgtttggcaacgccaccgtcatg
ggcttggctaagggccccgtgcggatgtggctgaacaggcgcgtgctcgaccatgcgaac
tggcagtatgaccaggatagggcagtgctgttgctgtatgggttgaatcatctgttcccc
cagggtgcgtggacggataaatgggagattaactgggagtaa

DBGET integrated database retrieval system