KEGG   Thermothelomyces thermophilus: MYCTH_2294679Help
Entry
MYCTH_2294679     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm00020  Citrate cycle (TCA cycle)
mtm00190  Oxidative phosphorylation
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01130  Biosynthesis of antibiotics
mtm01200  Carbon metabolism
Module
mtm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtm_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCTH_2294679
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MYCTH_2294679
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MYCTH_2294679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 11505749
NCBI-ProteinID: XP_003658647
JGI: 2294679
UniProt: G2Q275
LinkDB All DBs
Position
1:complement(join(1506006..1506225,1506331..1507554,1507641..1507969,1508046..1508119,1508212..1508266,1508411..1508455))
Genome map
AA seq 648 aa AA seqDB search
MASTMAWRRLAAAPALSRAARNPIRAFSTTRPVARVIANGPLRAKEASPFVSSKYPVIDH
EYDAIVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWR
WHMYDTVKGSDWLGDQDAIHYMTREAPASIVELENYGCPFSRTEDGKIYQRAFGGQSQKY
GKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAIDLIMQDGECRGVLAYNQE
DGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGI
YGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPE
KDHIYLQLSHLPPEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTGE
VLTVDENGNDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDKFTPGA
KLKPIEADAGAQSIETLDKIRNSNGPKSTAEIRLAMQKTMQREVSVFRTQESLDEGVRQI
TEVDQMFSQVGIKDRSMIWNSDLVETLELRNLLTCAVQTAVSAANRKESRGAHAREDYPE
RDDKNWMKHTLSWQKTPHGKVELSYRRVIDTTLDENECKPVPPMKRVY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcttccacaatggcttggaggcgcctagccgcggcgccggcgctctcgcgtgccgcc
agaaacccgatccgcgcattttccacaacacggccagtcgcccgcgtcatcgccaacggg
ccgctccgtgcgaaggaggcgtccccgttcgtaagcagcaagtacccggtcatcgatcat
gagtacgacgccatcgtggtcggtgccggcggtgccggtctgcgtgctgccttcggtctt
gccgaggccggcttcaacacggcttgcatttccaagctcttccccactagaagccacacg
gtcgctgcccagggtggcatcaacgccgctctcggcaacatgcatgaggacgactggcgg
tggcacatgtacgacacggtcaagggctccgactggcttggcgaccaggacgccattcac
tacatgacccgtgaggctcccgcctccatcgtcgagcttgagaactacggctgccccttc
tcccggaccgaggatggcaagatctaccagcgtgctttcggtggtcagtcccagaagtac
ggcaagggcggccaggcctaccgctgctgcgccgccgctgaccgtaccggccacgccctg
ctccacaccctctacggccagtcgctcaggcacaacaccaactacttcattgagtacttc
gctatcgacctgatcatgcaggacggcgagtgccgtggtgtcttggcgtacaaccaggag
gacggcacgctgcatcggttcctcgccaacaacaccgtcctggccaccggtggctacggc
cgcgcctacttcagctgtacctcggcccacacctgcaccggtgacggcatggccatggtc
gcccgtgccggtctgcccaaccaggatctcgagttcgtccagttccatcccactggtatc
tacggggccggctgcctgatcaccgagggtgctcgcggtgagggtggctacctcctcaac
tcggagggcgagcgcttcatggagaggtacgccccgacggccaaggatcttgccagccgc
gacgtcgtctcgcgttccatgaccatggagatccgcgagggccgcggtgtcggccccgag
aaggaccacatctacctccagctcagccacttgccccccgagatcctcgccgagcgtctc
cccggtatctcggagaccgccggtatctttgccggcgtcgacgttcgcaagcagcccatc
cccgtccttcccaccgtccactacaacatgggcggcattccgacccgctacaccggtgag
gtccttaccgtggacgagaatggcaacgacaaggtcgtccccggtctcttcgcctgcggt
gaggctgcctgcgtctccgtccacggtgccaaccgactgggtgccaactcgctgctcgac
ctggtcgtcttcggccgtgccgtctcgcacaccatccgcgacaagttcacccccggcgcc
aagctgaagccgatcgaggccgacgccggcgcccagtcgatcgagacgctcgacaagatc
cgcaactcgaacgggcccaagtccaccgccgagatccgcctggccatgcagaagaccatg
cagcgcgaggttagcgtcttccgtacccaggagagcctggacgagggtgtcaggcagatc
accgaggtcgaccagatgttctcgcaggtcggcatcaaggaccgcagcatgatctggaat
tcggacctcgtcgagacccttgagctccgcaacctgctcacttgcgctgtgcagaccgcc
gtctcggccgcgaaccgcaaggagtcccgtggcgcccacgcccgtgaggactatcccgag
cgcgacgacaagaactggatgaagcacacgctcagctggcagaaaacgccgcacggcaag
gtcgagctctcgtaccgccgcgtcatcgacaccaccctcgacgagaacgagtgcaagccc
gtgcccccgatgaagcgtgtctactaa

DBGET integrated database retrieval system