KEGG   Thermothelomyces thermophilus: MYCTH_2295190Help
Entry
MYCTH_2295190     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm00020  Citrate cycle (TCA cycle)
mtm00190  Oxidative phosphorylation
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01130  Biosynthesis of antibiotics
mtm01200  Carbon metabolism
Module
mtm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtm_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCTH_2295190
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MYCTH_2295190
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MYCTH_2295190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_18 SF3a60_bindingd
Motif
Other DBs
NCBI-GeneID: 11505657
NCBI-ProteinID: XP_003658864
JGI: 2295190
UniProt: G2Q420
LinkDB All DBs
Position
1:complement(join(2248263..2248583,2248644..2248795,2248896..2249265))
Genome map
AA seq 280 aa AA seqDB search
MAALRSTTSMLLGAASRPALRATAAVPAAVRGMAQVSDATASGDKPRLKTFQIYRWNPDT
PTEKPRMQSYTLDLNKTGPMVLDALIRIKNELDPTLTFRRSCREGICGSCAMNINGTNTL
ACLCRIPREDSSDMKIYPLPHTYVVKDLVPDLTQFYKQYKSIKPYLQRDTPSPDGKEYRQ
SREDRKKLDGLYECILCACCSTSCPSYWWNSEEYLGPAILLQSYRWLADSRDERKAERKE
ALNNSMSLYRCHTILNCTRTCPKGLNPGLAIAQIKKEMAF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcagctctccgctcaaccacctctatgctcctcggcgccgcgtccaggccggccctg
cgcgcgactgccgcggtgcctgccgccgtgcgcggcatggcccaagtctccgacgccacg
gcctcgggcgacaagcccaggctcaagaccttccagatctaccgctggaaccccgatacg
cctaccgagaagcccaggatgcagagctataccctcgatctgaacaagaccgggcccatg
gtcctcgacgccctgatccgcatcaagaacgagctcgacccgaccctgaccttccgccgg
agctgccgtgagggcatctgcggcagctgcgccatgaacatcaacggcaccaacactctc
gcgtgcttgtgccgcatcccccgcgaggacagctccgacatgaagatctacccgcttccg
cacacctacgtcgtcaaggatctggtgcccgacctcacccagttctacaagcagtacaag
tcgatcaagccgtacctgcagagggacacgccctcgccagacggcaaggagtacaggcaa
tccagggaggaccgcaagaagctcgacggcctctacgagtgcatcctgtgcgcgtgctgc
tcgacctcgtgcccctcgtactggtggaactcggaggagtacctgggccccgccatcctg
ctccagtcgtaccgctggctggccgattcccgtgacgagaggaaggccgagcgcaaggag
gccctcaacaactcgatgagcctgtaccgctgccacaccattctcaactgcacccggaca
tgccccaagggcctcaaccccggcctggcgattgcccagatcaagaaggagatggctttc
taa

DBGET integrated database retrieval system