KEGG   Thermothelomyces thermophilus: MYCTH_2297307Help
Entry
MYCTH_2297307     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MYCTH_2297307
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtm02000]
    MYCTH_2297307
Enzymes [BR:mtm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MYCTH_2297307
Transporters [BR:mtm02000]
 Other Transporters
  Pores ion channels [TC:1]
   MYCTH_2297307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 11511644
NCBI-ProteinID: XP_003659837
JGI: 2297307
UniProt: G2Q554
LinkDB All DBs
Position
1:6136967..6137938
Genome map
AA seq 323 aa AA seqDB search
MATIDTSLIPNATGAAASLAAQHAAPHRLRLYGGWFCPFVQRAWIVLVEKRIPHQYVEIN
PYKKEEALLRLNPRGLVPTLAIDEDKEEEEEEKRGSKRKQRALYESTVICEYLDERYADE
ARHGPRLLPGSGPRSSSSSREPGAEEEEEEKEGEEDGAYERARCRLWINHVVTRVVPGFY
RLLQHTPDKPYPIEEARAEFLKGLREFAAEMVASGSGRAGPYFLGARFSLVDVVLAPWAK
RLFLIDHYKPGGVGIPKKGERRPGEEEEVWARWDRWFEAVVERDSVKATWSDDEKYVEAY
RRYAEDTTQSEVGQATRQGRILP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggccacgatcgacacatccctcatccccaacgccactggcgctgccgcctcgctcgcc
gcgcaacacgccgccccgcaccggctgcggctctacggcggctggttctgcccctttgtc
cagcgcgcctggatcgtcctggtcgagaagcgcatcccccaccagtacgtcgagatcaac
ccgtacaagaaggaggaggccctgctgcggctcaacccgcgcgggctggtgcccacgctg
gccatcgacgaggataaggaagaggaggaggaggagaagagggggtcaaaaaggaagcag
cgggccctgtacgagagcaccgtcatctgcgagtacctggacgagcgctacgcggacgag
gcacgccacgggccccggctgctgccgggatcggggccgaggtcgtcgtcgtcgtcacgg
gagccaggagcggaggaggaggaggaggagaaggagggtgaagaagacggggcatacgag
cgggcgcggtgccggctgtggatcaaccacgtggtcacgagggtggtgcccgggttctac
cggctgctgcagcacacgcccgacaagccgtacccgatcgaggaggcgcgggccgagttc
ctcaagggcctgagagagttcgccgccgagatggtggcctcggggagcggtcgggccggg
ccgtacttcctcggcgcccggttcagcctggtcgacgtcgtgctcgcgccctgggccaag
cggctgttcctgatcgaccactacaagccgggcggggtgggtattccgaagaagggcgag
aggcgcccgggcgaggaggaggaggtctgggcccggtgggacaggtggttcgaggccgtc
gtcgagcgggacagcgtcaaggcgacgtggagcgacgacgaaaagtacgtcgaggcgtac
aggcggtatgccgaggacacgacccagtcagaggttggccaggcgacgaggcagggccgg
attctgccctaa

DBGET integrated database retrieval system