KEGG   Thermothelomyces thermophila: MYCTH_2297816Help
Entry
MYCTH_2297816     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    MYCTH_2297816
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MYCTH_2297816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 11509154
NCBI-ProteinID: XP_003660039
JGI: 2297816
UniProt: G2Q714
LinkDB All DBs
Position
1:join(6937961..6937973,6938220..6938399,6938476..6938627,6938682..6938778,6938838..6938860)
Genome map
AA seq 154 aa AA seqDB search
MVKAVAVVRGDSKVTGTVVFEQESESAPTKITWDISGHDPNAKRGFHIHTFGDNTNGCTS
AGPHFNPHGKNHGAPTDENRHVGDLGNIETDAQGNSKGSVTDSLIKLIGPESVIGRTVVV
HAGTDDLGKGGNEESLKTGNAGPRPACGVIGISQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggctgtcgctgtcgtccggggtgactccaaggtcaccggcaccgtcgtcttc
gagcaggagtccgagtccgcccctaccaagattacctgggacatcagcggccatgatccc
aacgccaagcgtggcttccacatccacaccttcggtgacaacaccaacgggtgcacctcg
gccggcccgcacttcaacccccacggcaagaaccacggcgccccgaccgacgagaaccgc
cacgtcggtgacctcggcaacattgagactgatgcccaaggcaactccaagggctctgtg
acggacagtctcatcaagctgatcggccccgagagcgtcatcggccgcaccgtcgttgtc
cacgccggcaccgatgatctcggcaagggcggcaacgaggagtcgctcaagaccggcaac
gccggcccgcgccctgcgtgcggcgtcatcggcatctcgcagtaa

DBGET integrated database retrieval system