KEGG   Thermothelomyces thermophila: MYCTH_2300079Help
Entry
MYCTH_2300079     CDS       T02231                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00052  Galactose metabolism
mtm00500  Starch and sucrose metabolism
mtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MYCTH_2300079
   00500 Starch and sucrose metabolism
    MYCTH_2300079
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MYCTH_2300079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 11511763
NCBI-ProteinID: XP_003661084
JGI: 2300079
UniProt: G2QAE3
LinkDB All DBs
Position
2:complement(join(385779..386812,386959..387715,387800..388527,388604..388850))
Genome map
AA seq 921 aa AA seqDB search
MIGTRLAGLGLLVAGVCSASASTSAIELRSAERPLSECPGYQAVNVKTSATGLTADLRLA
GSPCNTYGTDLEKLRLEVTYETENRLHVKIRDADELVYQVPESVFPRPKADGISAKKSAL
TFKYKANPFSFSVSRTKTGEVLFDTSAAPLVFQSEYLRLRTKLPENPNLYGLGEHSDPFR
LNTTNYIRTLWSQDSYSTPEGANLYGNHPVYFEHRKSGTHGVFFLNSNGMDIKIDKNPQH
LEYNTLGGVFDFYFVAGPSPVDVARQYAEISGLPAPVPYWSFGFHNCRYGYRDVYDVAEM
IYNYSAARIPLETSWIDIDYMDRRRVFTNDPERFPMPLLRMLADKLHSNNQHLIVMVDPA
VSYSPNPAYQRGIEDNVFLKRSNGSEWLGVVWPGVTVFPDWFSANITRYWNNEFAQFFSK
ETGLDIDGLWIDMNEPSNFPCFFPCDDPFSAAVGYPPDPPPVRPAAPRPLPGWPCEFQPE
GSNCTQQQEEATPSVSLPRHGIEPRTAPIANPPRGDNKWKGLPGRDLLFPKYSIHNKAAY
KDSWNGKHGGLSNKTVNTDVIHANGLAEYDVHNLYGTMMSVQSRQAMLSRRPGLRPFIIT
RSTFAGAGASVGKWLGDNLSTWDHYRAVIRTVMAFTSIYQVPMVGADVCGFGGDTTESLC
ARWAMLGAFSPFYRSHNELGSIPQEFYRWPTVAEAARKAIDIRYRLLDYIYTAFQQQTVD
GTPAVSPMFFLYPNDANTFGLDLQYFYGPGLLVAPVTEEGATSVDVYLPKDIFYDWYTHK
AIRGQGKTIRVSNQGLTDIPLFLRGGVIIPARVKSAMTTTELREQNFELLIPVGADGTAT
GQLYLDDGVSLEQKGTTLITFRYRNGVLTARGTFGYHTKAKITKVTVIGASRKRDEEADT
AVVTVNQPLTGNFEIKISGAL
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcactcgtctcgcaggcctcggcctgcttgtagctggcgtttgctccgcttct
gccagcacgtcggcaattgagctacgctctgctgaacgacccttgagcgagtgtcccgga
taccaagcggtcaacgtcaagaccagtgccacaggtctcactgccgacctgagactcgcc
gggagtccctgcaacacctacgggactgacttggagaagcttcgcctggaagtcacctac
gagactgaaaaccgtcttcacgtcaaaatcagggacgccgacgagctggtctaccaagtg
ccagagagtgtcttcccgcgtcccaaggccgacggcataagcgcaaagaagtcggcgctc
acgttcaagtacaaggccaaccccttctccttctcggtctcgcggaccaagacgggggag
gtcctgttcgacacctcggccgctcccctcgtcttccaatcggaatacctccgcctgagg
accaagctgccggagaacccgaacctctacgggctcggcgagcacagtgacccgtttcgg
ttgaacacgaccaactacatccgcaccctctggagccaggacagctatagcacgccagaa
ggggccaacttgtacgggaaccacccggtgtactttgagcaccgcaagagcggaacgcac
ggcgtgttcttcctcaactcgaacgggatggacatcaagattgacaagaatccccaacat
ctcgagtacaacacgctaggcggcgtcttcgacttttactttgtggccggcccgagcccc
gtcgacgtcgcgcggcagtacgccgagatcagcggactgcctgcccctgttccgtactgg
tcctttggcttccacaactgccgttatggataccgggacgtatatgacgttgcggagatg
atatacaactacagtgccgcgcgcattcctctcgagacgagctggatagacattgattat
atggaccggagaagggtcttcactaacgatccggaaaggttcccgatgcctctcctgcgg
atgcttgcggacaaacttcactccaacaaccagcacttgattgtgatggtcgaccctgcg
gtctcgtactcgccgaaccccgcgtatcagcgcggcatcgaggacaacgtctttctcaag
cgcagcaatggctcggaatggctgggtgtcgtgtggcccggcgtcaccgtgtttcccgac
tggttctcggccaatatcaccaggtattggaacaacgagtttgcccagttcttctccaag
gaaactggcctcgacattgacgggctctggatcgacatgaatgagccgtccaacttcccc
tgcttcttcccctgcgacgaccccttctcggccgcggtaggatatcccccggacccgccc
cccgtgcggcccgctgcaccacgcccgctgcctgggtggccgtgcgaattccaacccgag
ggttccaactgcactcaacaacaggaggaggctacgccatcagtcagccttccacggcac
ggaattgagccaaggacagcgccgatcgccaatccgcctcgcggcgacaacaagtggaaa
ggccttcctggccgcgacctgctcttccccaagtactcgatccacaacaaggcagcgtac
aaggattcgtggaacggaaagcacggcggactctcgaacaagaccgtcaacaccgatgtc
atccatgcgaacggcctggccgaatacgatgtccacaacctatacggcaccatgatgtcg
gtgcaatcgcgtcaggctatgttgtccagacgacctggtctccggccattcatcatcacg
aggtcgacttttgccggggcgggtgcatcggttgggaagtggttgggcgataatctgtcc
acttgggaccactaccgcgccgtcatccggactgtgatggccttcacgtccatctatcag
gtgcccatggtcggcgccgacgtctgcggcttcggcggcgacacgaccgaatcgctctgc
gctcggtgggcgatgctcggcgctttcagcccgttctaccggtcgcataacgaactcggc
tctatcccgcaggagttttaccgctggcccacggtggccgaggccgctcgcaaggccatc
gatatccgctaccggcttctcgactacatttacaccgccttccagcagcaaaccgtcgac
ggcactcccgccgtcagccccatgttcttcctgtaccccaacgacgcgaatacctttggc
ctcgacctccagtacttctacggtcccggtttgctggtcgcgccggtcaccgaggagggc
gcaacaagcgtggacgtctacctgccgaaggacatcttctacgactggtacacgcacaag
gccatccgtggacagggcaagacgatccgcgtcagcaaccaggggctgaccgacatcccg
ctcttcctgcgcggtggcgtcatcattcccgcccgggtcaagtcggccatgacgacgact
gagctgcgcgagcagaactttgagctgctcatccccgtgggtgcagacggaacagcgaca
ggccagctgtacctggatgacggcgtcagtctcgagcagaaagggacgacgctcatcacc
ttcaggtacaggaacggcgtcttgacggcgaggggcacttttgggtaccataccaaggcc
aagatcaccaaggtgacggtgatcggagctagccgcaagagggacgaagaggcggacacg
gcggttgtgactgttaaccagccgctgactggcaacttcgaaatcaaaattagcggtgct
ttgtag

DBGET integrated database retrieval system