KEGG   Thermothelomyces thermophila: MYCTH_2301830Help
Entry
MYCTH_2301830     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MYCTH_2301830
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MYCTH_2301830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 11510719
NCBI-ProteinID: XP_003661914
JGI: 2301830
UniProt: G2QAB9
LinkDB All DBs
Position
2:join(3625991..3626605,3626687..3626794)
Genome map
AA seq 240 aa AA seqDB search
MVNFSNLLQFLSLQSPLGSDSTNSTLNLAKMGITAYTLPALPYAYDALEPHISAQIMELH
HSKHHQAYVTNLNKALEAHVTAVAQGDVAAQIALQQAIKFNGGGHINHSLFWKNLAPAGS
DEASLDRASTLVKEIEKTWGSFDQFKAAFSAALLGIQGSGWGWLVREAGNGAGLRIVTTK
DQDPVVGGDVPIFGVDMWEHAYYLQYLNGKAAYVENIWNVINWKTAEDRFAGRSEEKTEL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacttcagcaacctgctccaattcctctccctgcagtcgccactcggctccgac
agcaccaacagcacgctcaacctcgccaaaatgggcatcacagcgtataccctcccggcc
ttgccgtacgcctacgacgcgctggagccgcacatctcggcccagatcatggagctgcac
cacagcaagcaccaccaggcctacgtgaccaacctcaacaaggccctcgaggcgcacgtc
acggccgtcgcgcagggcgacgtggccgcccagattgcgctgcagcaggcaatcaagttc
aacggcggcgggcacatcaaccactcgctcttctggaagaacctggcgcccgcgggcagc
gacgaggcgagcctggaccgggcgagcaccctggtcaaggagatcgagaagacgtggggc
agcttcgaccagttcaaggccgccttctcggccgccctgctcggcatccagggcagcggc
tggggatggctggtccgcgaggcgggcaacggcgccggcctgcgcatcgtcaccaccaag
gaccaggacccggtcgtcggcggggacgtgcctatcttcggcgtcgacatgtgggagcac
gcgtactacctccagtacttgaacggcaaggcggcatacgttgagaacatctggaacgtg
atcaactggaagacggctgaggaccggtttgcgggacggtccgaggagaagaccgaactt
tga

DBGET integrated database retrieval system