KEGG   Thermothelomyces thermophila: MYCTH_2304549Help
Entry
MYCTH_2304549     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00730  Thiamine metabolism
mtm00790  Folate biosynthesis
mtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    MYCTH_2304549
   00790 Folate biosynthesis
    MYCTH_2304549
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtm04147]
    MYCTH_2304549
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mtm00537]
    MYCTH_2304549
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MYCTH_2304549
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCTH_2304549
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mtm00537]
 Enzymes
  MYCTH_2304549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme SSP160 Mid2
Motif
Other DBs
NCBI-GeneID: 11507723
NCBI-ProteinID: XP_003663097
JGI: 2304549
UniProt: G2QER9
LinkDB All DBs
Position
3:join(2546979..2546981,2547090..2548407,2548522..2549069)
Genome map
AA seq 622 aa AA seqDB search
MSPRSERTPLLADSPRNSEESTRAAEEEDAALHGGNAAATLSSSNEHRRGVREVLLFVWA
VIATAGVIVLAVILQHRNATSGTPSPISPSDPSAGGPYTATTTTTTTTTTTTTTTTTTNT
DTNAGLHSKKRNLIFMVSDGMGPASLSLTRSFRQHVQSLPASDVLTLDAHFWGTSRTRST
NSLVTDSAAGATAFSCGRKSYNGAIAMLDGHRPCGTVLEAAKRKGFRTGLVVTTDVTDAT
PASFAAHVDVRWQMDEIALHEVGAGPLGRSVDLILGGGRCHFLGNGTRGSCRNDDVDVLG
LARDRFGWAFKGDRQGFDELQLGRNATLPLLGLFADADVPFEIDRRNMADVYPSLSEMAT
TALTVLDEATKHADHGFFLMIEGSRIDHAGHFNDPAAQVREVLEYDKTFKIVLDYLAKSD
TEGVLVATSDHETGGLSTAWQAPGEAPVYDWYPAVLAKANASAEHLTRLLNEHVAANPGE
SEQSLKDWINKELVVGRLGITDALETELAALAADPAGANPVFCRIVSTRAHIGWSTHGHS
AVDVNIYSSGGPAAEKIRGNVENTDIGKFLSEYLDVDVDAITKELEGKFAARRGGADATA
ETKTGAAAEGFALLSGHRPAAQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgaggtcggagcgcacgccgctcctggccgacagccctcgcaactcggaggag
tcgactcgcgccgccgaagaagaagatgctgccctgcatgggggcaacgccgccgcgacc
ctctcctcgtctaatgaacaccgccgcggcgtgcgggaggtgctcctcttcgtctgggcc
gtcatcgccaccgccggcgtcatcgtcctcgccgtgatcctccagcaccgcaacgcaact
tcgggcacgccctcgccgatctctcccagcgacccctccgccggcggaccctacaccgcg
acgacgacgacgacgacgacgaccaccaccaccaccaccaccaccaccaccaccaacacc
gacacgaatgccggactccactccaagaaacgcaacctcatcttcatggtctcggacggg
atgggcccggcgtcgctgagcctgacgcgctccttccggcagcacgtccagtccctgccc
gcgtcggacgtgctcacgctcgacgcccacttctggggcacgtcgcggacccggtcgacc
aactcgctcgtcacggactcggccgcgggcgcgacggccttctcgtgtggccgcaagagc
tacaacggcgccatcgccatgctcgacggccaccgcccctgcggcaccgtcctcgaggcc
gccaagcgcaagggcttccggaccggcctggtcgtcaccaccgacgtgaccgacgccacc
ccggcctccttcgccgcccacgtcgacgtgcgctggcagatggacgagatcgcgctgcac
gaggtcggcgccggcccgctcggccgctccgtcgacctcatcctgggcggcggccggtgc
cacttcctcggcaacggcacgcgcgggagctgccggaacgacgacgtcgacgtcctcggc
ctcgcccgcgaccggttcggctgggccttcaagggcgaccgccaagggttcgacgagctg
cagctcggcaggaacgcgaccctgccgctgctcggcctcttcgccgacgccgacgtcccc
ttcgagatcgaccgccgcaacatggccgacgtctacccgagcctgagcgagatggccacc
acggccctgacggtgctcgacgaggcgaccaagcacgccgaccacggcttcttcctcatg
atcgagggcagccgcatcgaccacgccggccacttcaacgaccccgccgcccaggtcagg
gaggtgctcgagtacgacaagacgttcaagatcgtgctcgactatctggccaagtcggac
accgagggtgtcctggtggccaccagcgaccacgagaccggcggtctatctaccgcttgg
caagcccctggcgaggcccccgtctacgactggtacccggccgtgctggccaaggccaac
gcctcggccgagcacctcacacggctcctcaacgagcacgtggccgcgaacccgggcgag
tcagagcagtcgctcaaggattggatcaacaaggagctggtcgtgggccgcctcggcatc
acggacgccctcgagacggagctcgccgccctcgcggccgacccggccggcgccaacccg
gtcttctgccgcatcgtcagcacccgcgcccacatcggctggagcacccacggccacagc
gccgtcgacgtcaacatctacagctccggcggcccggccgccgagaagatccgcggcaac
gtcgagaacaccgacattggcaagttcctcagcgagtacctcgacgtcgacgtcgacgcc
attaccaaggagctcgagggcaagtttgccgcccggcgcggtggtgccgacgccacggcc
gagaccaaaaccggcgccgcggccgagggttttgccctgttgagcgggcatcgccccgcg
gcccagtga

DBGET integrated database retrieval system