KEGG   Thermothelomyces thermophila: MYCTH_2304601Help
Entry
MYCTH_2304601     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MYCTH_2304601
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mtm03400]
    MYCTH_2304601
Enzymes [BR:mtm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MYCTH_2304601
DNA repair and recombination proteins [BR:mtm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     MYCTH_2304601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C RNA_ligase BRCT LIG3_BRCT DNA_ligase_IV
Motif
Other DBs
NCBI-GeneID: 11507750
NCBI-ProteinID: XP_003663124
JGI: 2304601
UniProt: G2QBD6
LinkDB All DBs
Position
3:complement(join(2639383..2642353,2642460..2642566))
Genome map
AA seq 1025 aa AA seqDB search
MSSRNKRAKSPDVDAIEEDEKQYGSGSLSLAELDEHFPNRPRNHSKTPPFSHLFQHLFNP
LIECKPTTAGAAAGATRRTARGGAGGRGASSKLSYHEQRRHIVERFMSRWRAEVGPDFYP
AMRLILPDKDRDRGVYGLKENTIGKLLVKVMKIDRNSEDGYALMHWKLPGGHGGGGGGGG
GRFGGGAISTAGDFAGRCYEIVKKRQMRSEPGEFTIGDVNVMLDRLAAASGEAEQLPIFE
EFYQGMNAEELMWLVRIILKDMKVGATERTFLGLWHPDAEALFSVSSSLRRVCWELYDPE
FRLEQQETGVTLMSCFQPQLAQFQMTTTFAKLVANLGVTDENPEFWIEEKLDGERMQMHM
REDDSVPGGYRFAFWSRKAKDYTYLYGSGLEDNNSALTRHLKGAFDSGVRNLILDGEMIT
WDPEVDKIVPFGTLKTAALDQQKNPFHSGPRPLYRVFDILLLNDKSLTEYTLADRHRALE
RAVKGAPRRLEIHPYVSATSADEIEPLLRAVVAEASEGLVLKNPRSRYQLNSRNNDWIKV
KPEYMSEYGESLDLVVVGGYWGSGRRGGTLSSFLCGLRVSENFVRSGAAASREKCLSFCK
VGGGFKAEDYAEMRHHTEGKWREWDPASPPSEFVELGGGERLQYERPDVWIRPSESVVIS
VKAASFAPSDQFATGWTLRFPRFRKLRLDKAWDAGMDVDELEALRSKVKQEEKERKAMEM
ENRKRKPAKRQKRELVIAGAADLAGATADFLAVKKPKTDLFRGLDFCVLSEAVKPKKMSK
PDLEKLIKENGGRIHQTVEKGSGMIILADKNVVRVASLKKAGDADIVRPKWVFDCLEQSG
GEGYLLPFEEGHLLSATEEMRKLAEESTDQYGDSYARDVGVDELRDILEQMELPEEGSHF
DVDNFLDQLEEHGRGLDGLESFMFRRCRVHFALGEGVPESRALKLMNYVRFGNGEVVSDI
EDKRITHVVVVGGKGETSASERVVAADVRYKVSSRRAVPRVVSARWVEDCWREGTLVDEE
EYAPT
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcgaaacaagcgtgccaagtccccggacgtcgatgcgatcgaggaggatgag
aaacagtacggcagcggctccctcagtcttgcagagctcgacgagcactttcccaaccga
ccccgcaaccactccaagacaccacccttctcgcacctcttccagcatctgttcaatcct
ctgatagaatgcaagcccaccaccgccggcgctgcggcgggcgccacccggcggaccgcc
cgcggcggggccggaggccggggcgcctcctccaagctctcgtaccacgagcagcgccgc
cacattgtcgagcgcttcatgtcgcgctggcgcgccgaggtcggcccggatttctacccg
gccatgcgcctcatcctgccggacaaggaccgcgaccgcggcgtgtacgggctcaaggag
aacaccatcggcaagctgctcgtcaaggtcatgaagattgaccgcaactcggaggacggc
tacgcgctgatgcactggaagctccccggcggccacgggggcggcggcggcggcggcgga
gggaggttcggtggcggggcgatcagcacagccggggatttcgcgggcaggtgttacgag
attgtgaagaaacggcagatgaggagcgagcccggggagttcacgatcggggacgtgaat
gtgatgctggaccggctggccgcggcgagcggtgaggccgagcagctgcccatctttgag
gagttttaccagggaatgaatgccgaggagctgatgtggctggtgcgcatcatcctcaag
gatatgaaggttggcgcgaccgagaggacgttcctggggctgtggcatcccgacgccgag
gcgctcttcagcgtctcgtcgagcctgaggagggtctgctgggagttgtacgacccggag
tttcgcctcgagcagcaggagacgggtgtgacgctcatgtcgtgcttccagccccagctg
gcgcagttccagatgacgacgacatttgcgaagctggtggcgaacctgggagtcacggat
gagaaccccgagttctggatcgaggagaaactggacggcgagcggatgcagatgcacatg
cgggaggatgactcggtgccgggagggtacaggttcgccttctggtctcgcaaggccaag
gactacacctatctgtacggaagcgggctggaagataacaactcggccctcacccggcat
ttgaagggggcctttgacagcggcgtccgcaacctcatcttggacggcgagatgatcacc
tgggaccctgaagtcgacaagattgtgccctttggtaccctcaagactgccgccctggac
cagcagaaaaaccctttccacagcggcccacgcccgctctaccgcgtgtttgacatactt
ctcctcaacgacaagtcgctcaccgagtacacgctcgccgaccggcaccgggccctcgag
cgtgccgtcaagggggcgcctcgccgtctcgagattcacccgtacgtctcagccacgtcg
gccgacgagatcgagccgctccttcgcgccgttgtggccgaggcctcggagggactcgtg
ctcaagaacccgcgctcgcggtatcagctcaacagccgcaacaacgactggatcaaggtg
aagcccgagtacatgtccgagtacggcgagtcactcgacctggtcgtcgtcggcgggtac
tggggctcgggccgacgcggcggcacgctctcgagcttcctgtgcgggctacgcgtgagc
gaaaactttgtgcggtcgggcgccgcggcgagccgggagaaatgcctcagcttctgcaag
gtcggtggcgggttcaaggcggaggattacgccgagatgcggcaccacaccgagggcaag
tggagggagtgggacccggccagcccgccgtccgagttcgtcgagctgggcggcggcgaa
cggctgcagtacgagcgccccgacgtgtggatccgcccgagcgagtcggtcgtcatctcc
gtcaaggccgcgtcgttcgcgccgtcggaccagttcgccacgggctggaccttgcggttc
ccgcgcttccgcaagctgcggctggacaaggcgtgggacgccggcatggacgtggacgag
cttgaggcattgcggtccaaggtcaaacaggaggagaaggagcgcaaggcgatggagatg
gagaaccgtaaacgaaaaccggcaaagagacagaagagggagctggtcatcgccggcgct
gctgaccttgccggggccacggccgactttttggccgtgaagaaaccaaagaccgacctg
ttccgaggcttggatttttgcgtcttgtccgaggcggttaagccgaagaagatgagcaag
ccagacctggagaagctgatcaaggagaacggaggcaggatacaccagacagtggagaaa
ggctcgggcatgatcatcctggcggacaagaacgtcgtcagggtggcgagcctcaagaag
gcaggcgatgcggacattgtgcggccaaagtgggtgtttgactgtctcgagcagagcggc
ggggagggctatctgctcccgtttgaggaaggccatctcctttctgccaccgaggagatg
agaaagctcgccgaggagagtacggaccagtacggagacagctatgctcgggacgtgggc
gtcgatgagctgagagacatcctggaacagatggaactgcccgaagagggtagccacttt
gacgtcgacaacttcctcgatcagctggaggagcacggcaggggattggacgggctggag
agcttcatgttcaggaggtgccgggtgcactttgcgcttggggaaggagtgcccgagtct
agagcgctcaagctgatgaactacgtgcgatttggaaacggcgaggtggtgagtgatatc
gaagacaagaggattacgcacgtggttgttgtcggtgggaagggggaaacatccgcgtcc
gagagagtggtggcggcagatgtgaggtataaggtcagctcgaggagggcagtaccgagg
gttgtctctgcgaggtgggttgaggactgctggagagagggcaccctcgtggatgaggag
gaatatgcaccgacctag

DBGET integrated database retrieval system