KEGG   Thermothelomyces thermophila: MYCTH_2304904Help
Entry
MYCTH_2304904     CDS       T02231                                 

Definition
(RefSeq) methyltransferase-like protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    MYCTH_2304904
Enzymes [BR:mtm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MYCTH_2304904
Chromosome and associated proteins [BR:mtm03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MYCTH_2304904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRI SET WW Med26 Terpene_synth
Motif
Other DBs
NCBI-GeneID: 11507863
NCBI-ProteinID: XP_003663237
JGI: 2304904
UniProt: G2QBP9
LinkDB All DBs
Position
3:complement(join(3224426..3225292,3225363..3226951,3227043..3227439))
Genome map
AA seq 950 aa AA seqDB search
MEGSNRASGVVAGPETEERQKSNGLGTRMEEMGGSATPNGSRTDTRASSMSPDDAKPSAD
SISTPENGTAPKLSRKSSQKMARSPPPLFDHLPDATEEACSTFQVINDCLYGSRNMGSSD
HDALDCDCAEDWHDGQNHACGEDSDCINRATKIECVSGDCNCGEGCQNQRFQRKQYAKVS
VIKTEKKGFGLRADTDLQANDFVYEYVGEVINEPTFRSRMVKYDREGIKHFYFMSLTKNE
FVDATKKGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFAGRAIRAGEELVFNYNVDRYGA
DPQPCYCGEPNCVGFIGGKTQTERATKLPLATIEALGIDDGDSWDTTVAKKPRKKKAHEG
DEEYVNSLQPRALDEDGVTKVMAALMQCKEKWIAVKLLSRLQATEDDHLRHRVVRMHGYQ
ILKSTLNTFKDDMNVVLQILDILYQLPRITKNKISDSKIEGAVQPLVSAPHEEVALAAKR
LLDEWSKLETAYRIPRKKHDHAGPVVISSFEEERRNKDRDEPAKPVDPLANVVIPTGPRS
SIPQRNANYFTGQRPRKPPTNLPAGWFVTTDKTGRYYFYDVNGKTQWQRPLTPAIEIPKA
SAKAQQDQKTLQNIIDSLTKEPTPRHSTGHTPQRSTTPATEPKKEKWRSLPIEKQMKIYE
NTLFPHVKHVVDKFHGKLPKEELKKFAREVNKKLVASDYKNNRVEDPTSVTPKVAKKVRK
YTYDFFERAAVKYAEYEKKKKEARSTGQPVAGTSSHPGDADSSVATPAKDDTAASDAEGD
APSPGSSAGRKRKREDDDDGDQAESPEAPPSETQSVKRAKEDEAGADVETPTAIPSPPTP
PPPPMETPLTEEERSMREQEEALMRENEEAQRLEDEAAQAAEYGKQQRGSANGEAGTGVL
VNGVATAASPSTGTNGRGTEVGADVEMEIDEPPQQDAGNQQQQQRAVLSH
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaagcaatcgtgcttcgggggtagtggcgggcccggagaccgaggagaggcaa
aaatccaacgggctcgggacaagaatggaggaaatgggcggttcagccaccccaaacggc
tccagaaccgatacacgggcgtccagcatgtcgcctgacgacgcaaaaccaagtgccgac
agcatatcgaccccggagaacggcacagcaccaaagctgtcaaggaagtcctcgcagaag
atggccaggagtcctccgccactgttcgaccatcttccggatgccaccgaggaggcgtgc
agtacatttcaggtcataaacgattgtctctatggctctaggaacatggggtcgtcggat
cacgacgcgctggattgcgactgtgctgaagactggcacgacggccagaatcacgcctgc
ggtgaagactcggactgcatcaatcgggcgaccaaaatcgagtgcgtgagtggcgattgc
aattgcggggagggttgccagaaccagcggttccagcgcaagcagtatgccaaggtctcg
gtcatcaagacggagaaaaaaggcttcggcctgcgagcggatacggatctccaggccaac
gacttcgtctacgagtacgtcggtgaggtcatcaacgagccaacgttccgcagccggatg
gtcaaatacgacagggagggcatcaagcacttctacttcatgtcgctaaccaagaacgag
ttcgtcgacgccaccaagaaggggaacctgggcaggttttgcaaccattcgtgtaatccc
aattgctatgtggacaagtgggtggtgggcgaaaagctgcgcatgggcatctttgccggc
cgcgcgatccgggcgggcgaggagttggtcttcaactacaacgtcgaccggtacggcgcc
gatccgcaaccctgctactgcggcgagccgaactgtgtgggcttcatcggcggtaagacg
cagacagagcgcgcgaccaaattgccgctcgcgaccatcgaggcgctcggcatcgacgat
ggcgacagctgggacacgacggttgccaagaagccccgcaagaagaaggcccatgagggg
gatgaggagtacgtcaacagcctccagccccgcgccctggacgaggacggcgtcaccaag
gtcatggccgccctcatgcaatgcaaggagaaatggattgccgtcaagcttctctcgcgc
cttcaggccaccgaggatgatcatctccgccatagagtggtgaggatgcacgggtaccag
atcctgaagagcacgctcaacacgttcaaagacgacatgaacgttgtgctgcaaatcctc
gacatcctctaccagcttccccggatcacgaaaaacaaaatctcggattccaagatcgag
ggagcggtgcagcctctcgtctcggctccacacgaagaggttgccctcgctgcgaagcgg
ctactggacgaatggagcaagctggagacggcctaccggatcccgcgcaaaaagcacgac
catgctggcccagttgtcatcagctcgttcgaggaagagcgtcgcaacaaggatcgcgat
gagccggctaagcctgtcgaccccttagccaacgttgtgattccaactggaccccgcagc
agcatcccgcagcgcaacgccaattatttcaccgggcaacggccccggaaaccgcccacc
aacctgccggctggctggtttgtcaccacggacaagactggccgctactacttctacgac
gtcaacggcaagacacagtggcagcgacctctcacccctgcgattgagattccgaaggcg
tccgccaaggcgcagcaagaccaaaagactttgcaaaacatcatcgatagcttgaccaag
gagccgacgccacggcactcgacgggtcatacaccacaacggtctaccacgccggcgacc
gagcccaagaaggagaagtggcgttctctgcccatcgagaaacagatgaagatatacgaa
aacacgctctttccacacgtcaagcacgtggtggacaagttccatggcaagctgccgaag
gaggagctgaagaagtttgcccgggaggtcaacaagaagcttgtcgcctcggactacaag
aacaaccgggtcgaggacccgacatccgtcacacccaaggtggcgaagaaggtccggaag
tatacctacgacttcttcgagcgcgccgccgtcaagtatgccgagtacgagaagaagaag
aaggaggctcggagcaccggccagccagtagcggggacgtcatcacatccgggcgacgcg
gacagctccgttgccacccctgccaaggacgacacagctgcgtctgacgccgaaggcgac
gctcccagcccaggcagctcggcggggcgcaagcgcaaacgggaagatgacgacgacggg
gaccaggctgagtcgcccgaggccccgccatccgagacacaatccgtgaagcgcgccaag
gaggacgaggccggtgccgatgtcgaaaccccgaccgctatcccgagcccgcccacacca
cctcccccgccaatggaaaccccactgaccgaagaggagcggtcgatgcgcgagcaggag
gaagccctgatgcgcgagaacgaagaggctcagcggctggaggacgaggcggcacaggcc
gcagagtacggtaaacaacagcgtggcagcgcgaatggcgaggcaggcacgggcgtgttg
gtgaacggagtggcaacggcggcgtcgccgtcaacgggcactaacgggagaggaacggaa
gttggtgcggatgtcgagatggagattgacgagccgccgcaacaagacgcgggaaaccag
cagcagcagcagcgggcagtactgagtcactga

DBGET integrated database retrieval system