KEGG   Thermothelomyces thermophilus: MYCTH_2308202Help
Entry
MYCTH_2308202     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mtm  Thermothelomyces thermophilus
Pathway
mtm03030  DNA replication
mtm03410  Base excision repair
mtm03420  Nucleotide excision repair
mtm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MYCTH_2308202
   03410 Base excision repair
    MYCTH_2308202
   03420 Nucleotide excision repair
    MYCTH_2308202
   03430 Mismatch repair
    MYCTH_2308202
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mtm03032]
    MYCTH_2308202
   03400 DNA repair and recombination proteins [BR:mtm03400]
    MYCTH_2308202
Enzymes [BR:mtm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MYCTH_2308202
    6.5.1.6  DNA ligase (ATP or NAD+)
     MYCTH_2308202
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MYCTH_2308202
DNA replication proteins [BR:mtm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MYCTH_2308202
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MYCTH_2308202
DNA repair and recombination proteins [BR:mtm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MYCTH_2308202
   NER (nucleotide excision repair)
    Other NER factors
     MYCTH_2308202
   MMR (mismatch excision repair)
    Other MMR factors
     MYCTH_2308202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 11506907
NCBI-ProteinID: XP_003664957
JGI: 2308202
UniProt: G2QJF5
LinkDB All DBs
Position
5:1213939..1215582
Genome map
AA seq 547 aa AA seqDB search
MLIALSRAFLLSKPPGAEFATKDPKALAKLKKEELAEIWARSEELVKASYARHPDYNDLI
PVLLEIGISEELLVRCGLTLHIPLRPMLGNITRDLSEMLTKLQGRDFTCEYKYDGQRAQV
HCDSNGKVSIFSRHLELMTDKYPDLVALVPKIRGEGVESFILEGEVVAVDRATGELKNFQ
TLTNRARKDVAIGAITIDVCLFAFDLMYLNGQPLLDQPFRHRRDLLRSLFVEIPHHFTWV
RSLDATSQDSESVLEFFKSALDSKCEGIMVKTLDNLPDLEYCGDKEGPEQTGPELNSSFT
AKNSGSKSKRRDNGGSSNNNNNNNNNGPPKSRRKPLLATYEPDKRLDSWLKVKKDYSSSS
DTLDLIPIAAWHGQGRKAKWWSPILLAVRNEETGCLEAVCKCMSGFTDAFYKANREFYDD
GDEDSGVGRGRRNTHARKPGFVEYAGGVPDVWFEPCEVWEVAFADITVSPTYTAAIGLAK
EDRGLSLRFPRFLRKREDKGIEEASTSAYLAALWRKQEARAPQAAETAGQAAEEDELDDE
EAAAAEE
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcgctctttcgagggcttttctgttgtctaaaccaccgggcgcagagttcgca
actaaggatcccaaagccctggctaagctgaaaaaggaagaattagctgagatttgggcg
aggagtgaggaattggtaaaggcgtcttacgcgcgacatccggactacaacgacctcatc
cccgtgcttctcgagattggtatctcggaggaactcttagtccggtgcggcctcacctta
catatccccttgcggccgatgctgggaaacatcactcgtgatctctcagagatgctcacg
aagctgcaaggccgggattttacttgcgagtacaaatacgacggacagcgcgcgcaggtc
cattgtgactccaacggcaaggtctcgattttctccaggcatcttgaactgatgacagac
aaataccccgatttagtagccctggtccccaaaatcaggggggagggcgtcgagagtttc
atcttggagggcgaggtggtagccgtcgatcgtgccactggcgaattgaaaaactttcag
acgctcaccaatcgtgctcggaaggacgtcgccatcggggctatcacgatcgacgtctgc
ctctttgctttcgacctcatgtacctcaatgggcagcccctcctcgaccagccattccgc
cacagacgggatctgctgcggtcactctttgtcgaaatacctcaccatttcacctgggtc
aggagcctggacgctacctctcaggactcggagtccgttcttgaattcttcaagtctgcc
ctggacagcaagtgcgagggcatcatggtcaagacgctcgataacctacccgacctggag
tactgcggcgacaaagaagggcccgagcagacaggccccgaactcaactcaagtttcacc
gcgaagaatagcggtagcaaatctaaacgaagagacaacggcggcagcagcaacaacaac
aacaataacaacaacaacggcccgcccaaaagccgccgcaaaccgctcctggcaacctac
gaacccgacaaacggctcgactcgtggctcaaggtgaagaaggactactcctcctcatct
gacacgctggatctgatccccatcgctgcctggcatggccaaggccgcaaagccaagtgg
tggtctccaatcctcctggccgtgcgcaacgaggagacgggctgcctcgaggccgtgtgc
aagtgcatgtcggggttcaccgacgccttctacaaggccaaccgggagttttacgacgac
ggggacgaggacagcggagtcggccgggggaggcgcaacacgcacgcgcgcaaacccggg
ttcgtcgagtacgccggcggggtgccggacgtgtggttcgagccatgcgaggtctgggag
gtggcgttcgcggacatcacggtcagcccgacgtacacggcggcgatcgggctggcgaag
gaggatcgggggctgagcctgaggtttccgcgctttctaaggaagagggaggataaaggg
attgaggaggccagcacgagcgcgtacctggcggcgctgtggaggaagcaggaggcgagg
gccccccaagcggcagaaacggcggggcaggctgcggaggaggatgaattggacgatgag
gaggcggcggcggcggaagagtga

DBGET integrated database retrieval system