KEGG   Thermothelomyces thermophila: MYCTH_2308594Help
Entry
MYCTH_2308594     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00250  Alanine, aspartate and glutamate metabolism
mtm00410  beta-Alanine metabolism
mtm00430  Taurine and hypotaurine metabolism
mtm00650  Butanoate metabolism
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
Module
mtm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MYCTH_2308594
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCTH_2308594
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCTH_2308594
   00430 Taurine and hypotaurine metabolism
    MYCTH_2308594
Enzymes [BR:mtm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MYCTH_2308594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 11510920
NCBI-ProteinID: XP_003665160
JGI: 2308594
UniProt: G2QK09
LinkDB All DBs
Position
5:complement(join(2281317..2282582,2282664..2282708,2282785..2283075,2283139..2283192))
Genome map
AA seq 551 aa AA seqDB search
MAGTQGDKPLNRADELDHLIDAVKALIVPFVREADEAVPSRAAGELLPDSQGVVQNALVK
TRRPEDLVKELALNLPKGEGLGEEGLLQTMRDVLKYSVNTWDQGFMDKLYASTNPVGVAS
ELLLGALNTNVHVYQVSPALTVIEKHTARSLANLFGFTGPRAGGVTCQGGSASNLTSVVI
ARNTLYPECKTRGNSGGPSPFVLFTSVHGHYSVEKAAVTCGLGSSAVWTVPVDGEGRMDP
SALRTLVERAKAEGKTPLYVNATAGTTVLGSYDPFPEIAAVCAEFNLWLHIDASWGGPAI
FSPTHRHKLAGSHLANSLTVNPHKMMNVPVTCSFLLGPDMAVFHRANTLPAAYLFHGPGQ
EEEDTSRSSPAAAAGGPTTNGVNGTAAPNGTTTPSEQEREQKEEEEEVWDLADLTLQCGR
RADSLKLALSWVYHGAAGFARQVDGAFAVAAHLADLVARHPDFVLLSANPPPCLQVCFYH
APGGRLAEDPAVNTARTRRMARALVARGYMVDYAPGEKGSFFRVVVNAQTLTGTVEGLMK
ALEHVAREVVG
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctgggacgcaaggggacaagcccttgaaccgggcggatgagctcgaccatctcatc
gatgccgtgaaagccctgatcgtcccctttgtccgggaagccgatgaagcggtcccgtcc
cgggcggcgggggagttgcttccagacagccagggtgttgtgcagaatgccctcgtcaag
actcggagacccgaggacctggtcaaggagctggccttgaatctacccaaaggcgagggc
ctcggcgaagaagggctgctccagaccatgagggatgttctcaagtacagcgtcaacacg
tgggaccaggggttcatggacaagctgtatgccagcaccaatccggttggcgtcgcttct
gagcttctcctgggagcgctgaacacaaatgtgcatgtttaccaggtatcgcccgccctg
acggtgattgagaagcacacggccaggtccctggcaaacctctttggtttcaccggcccg
cgtgcggggggtgtgacctgccaaggaggtagtgcctcgaacctgacgtccgtcgtcatc
gcccgcaacacactctatccggaatgcaagactcggggaaacagcggcggcccgagccct
ttcgtcctcttcaccagcgtccacggccactactcggtcgagaaggcggccgtaacctgc
ggcctaggctcctccgccgtctggaccgtccctgtcgatggcgagggccggatggacccg
tcggcgctgcgcaccctcgtcgagcgcgccaaggcggagggcaaaacgcccctctacgtc
aatgccaccgccggcacgaccgtgctaggctcctacgaccccttcccggagatcgccgca
gtttgcgccgagttcaacctctggctgcacatcgacgcgagctggggcggccccgccatc
ttctccccgactcaccgccacaagctcgccggctcccacctcgccaactccctcaccgtc
aacccgcacaagatgatgaacgtgcccgtgacctgctccttcctcctcggtccggacatg
gccgtcttccaccgcgcaaatacccttcccgccgcctatctcttccacggtccggggcag
gaggaagaagacacttcgcgctcgtcgcctgcggcggcggcgggagggcccaccacgaac
ggagtaaacggcaccgccgctcccaacgggacgactaccccttcagaacaggaacgagaa
caaaaagaagaagaagaagaggtctgggacttggcggacctgacgctacagtgtggccgg
cgcgccgacagtctcaagctggccctcagctgggtgtaccacggcgcggccgggttcgcg
cggcaggtggacggggcgttcgcggtggcggcgcacctggccgacctggtcgcgcgccac
ccagacttcgtcctcctgtcggcgaacccgcccccctgcctgcaggtgtgcttctaccac
gcgcccggcggccggctcgccgaggacccggccgtcaacacggcccgcacccgccgcatg
gcccgcgcgctcgtcgcccggggctacatggtcgactacgctccgggggagaagggcagc
ttcttccgggtggtggttaacgcgcagacgctgacggggaccgtcgagggattgatgaag
gcgttggaacacgtagcgagggaggttgtcgggtga

DBGET integrated database retrieval system