KEGG   Thermothelomyces thermophila: MYCTH_2312383Help
Entry
MYCTH_2312383     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00020  Citrate cycle (TCA cycle)
mtm00310  Lysine degradation
mtm00380  Tryptophan metabolism
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01130  Biosynthesis of antibiotics
mtm01200  Carbon metabolism
Module
mtm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCTH_2312383
  Amino acid metabolism
   00310 Lysine degradation
    MYCTH_2312383
   00380 Tryptophan metabolism
    MYCTH_2312383
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MYCTH_2312383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 11509366
NCBI-ProteinID: XP_003667049
JGI: 2312383
UniProt: G2QQE1
LinkDB All DBs
Position
7:complement(join(2300253..2300794,2300904..2303487))
Genome map
AA seq 1041 aa AA seqDB search
MLRTSIRALQSAASSSSRCFSTATVSARANLRPTASRRPLALAAQKRFESALHNAPEPND
NFLQGNTANYIDEMYLQWKQDPESVHVSWQVYFKNMESGDMPISQAFTPPPSLVPSTQAV
VGLAAGAGVGIGEGADITNHLKVQLLVRAYQARGHHKSKIDPLGIRNASKGFGNIRPKEL
ELDYYQFTEKDLDTEYTLGPGILPRFRREGREKMTLREIVAACEKIYCGSYGVEFIHIPD
REKCDWLRERIEVPQPFKYSIDEKRRILDRLIWSSSFEAFLSTKYPNDKRFGLEGCETLV
PGMKALIDRSVDYGIKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTSGAEDEGSGDV
KYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKVRAIQHYNNDETTHRSAMAVL
LHGDAAFAAQGVVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARSTAYCTDIAKA
IDAPVFHVNADDVEAVNFVCQLAADWRAEFKQDVIIDLVCYRKHGHNETDQPSFTQPLMY
KRIQEKVPQLDIYVNQLLKEGTFTKEDIEEHKQWVWGMLEESFAKSKDYQPTSKEWTTSA
WNGFKSPKELATEILPHTPTGVDRKTLEHIGEVIGTAPEGFNLHRNLKRILANRTKSVLE
GKNIDWSTAEALAFGTMVTEGRHVRVSGQDVERGTFSQRHAVFHDQETEDTYTPLQHVSK
DQGKFVISNSSLSEYGALGFEYGYSLTDPNGFVMWEAQFGDFANNAQCIIDQFIASGEQK
WMQRTGLVMSLPHGYDGQGPEHSSGRLERFLQLCNEDPRVFPSAEKLQRQHQDCNIQVAY
PSTPANLFHILRRQMNRQFRKPLILFFSKSLLRHPLARSNIEEFTGDSQFQWVIADPAHE
TGAIKPHDQIDRVIICTGQVYAALHKYRAEKQIDDVAFTRIEQLHPFPWELLRENLDMYP
NAKTIVWAQEEPLNAGAWSYTQPRIETLLNQTKHHHRKHVMYAGRNPSASVATGLKASHT
KEEQDLLEMAFSVKQDKLKGE
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcacctccatccgggcgctacagagcgccgcctcgtcgtcgtcacgatgcttc
tcgacggccaccgtctcggcgcgcgccaacctcaggcccaccgcctcccgccgcccgctc
gccctcgccgcccaaaaacggttcgagagcgccctccacaacgcgcccgagccgaatgac
aacttcctccagggcaacacggccaactacatcgatgagatgtacctgcagtggaagcag
gaccccgagagcgtccacgtgtcctggcaggtctacttcaagaacatggagagcggcgac
atgcctatctcccaggcctttacccccccgccgtccctcgtgcccagcacccaggctgtc
gtcggcctcgctgctggcgccggtgtcggcattggcgagggtgccgacatcaccaaccac
ctcaaggtccagctgctcgtgcgcgcgtaccaggcccgcggccaccacaagtccaagatc
gaccccctcggcatccgcaacgcttccaagggcttcggcaacatccggccgaaagagctc
gagctcgactactaccagttcaccgagaaagatctcgacaccgagtacacgctgggcccc
ggcatcctgccgcgcttcaggcgcgagggccgcgagaagatgacgctccgcgagatcgtt
gccgcctgcgagaagatctactgcggctcctacggcgtcgagttcatccacatccccgac
agggagaagtgcgactggctgcgcgagcgcatcgaggtgccccagcccttcaagtactcg
atcgacgagaagcgccgcatcctcgaccgtcttatttggagctcgagcttcgaggccttc
ctgtccacaaagtaccccaacgacaagcgcttcggcctcgagggctgcgagacgctggtg
cccggcatgaaggcgctcattgaccgcagcgtcgactacggcatcaaggacattgtcatc
ggcatgccccaccgcggccgtctcaacgtgctgagcaacgtggtcaggaagcccaacgag
tccatcttcagcgagttcgccggcaccagcggtgccgaggacgagggctctggcgacgtc
aagtaccacctgggcatgaactttgagcggcccaccccctcgggcaagcgcgtgcagctg
tccctggtcgccaacccgtcgcatctcgaggccgaggaccccgtcgtcctcggcaaggtc
cgcgccatccagcactacaacaatgacgagaccacccaccgcagtgccatggccgtcctg
ctccacggcgatgctgccttcgccgcccagggcgtcgtctacgagtgtctcggcttccac
tcgctcccggccttctcgaccggcggcacgatccacctggtcgtcaacaaccagatcggc
ttcaccacggatccccgcttcgcccgctcgaccgcctactgcacggatatcgccaaggcc
atcgacgcccccgtcttccacgttaacgccgacgacgtcgaggctgtcaactttgtgtgc
cagttggctgccgactggcgtgccgagttcaagcaggatgtcatcatcgacctcgtctgc
taccggaagcacggccacaacgagacggaccagccgtccttcacccagcccctcatgtac
aagcgcatccaggagaaggtcccccagcttgatatctacgtcaaccagctcctcaaggag
ggtaccttcaccaaggaggacatcgaggagcacaagcagtgggtgtggggcatgctcgag
gagagcttcgccaagtccaaggactaccagcccacctccaaggagtggaccaccagcgcc
tggaacggcttcaagtcccccaaggagctggcaaccgagatcctcccgcacacgcctacc
ggcgtcgacaggaagacgctggagcacatcggcgaggtcatcggcaccgcgcccgagggc
ttcaacctccaccgcaacctgaagcgcatcctggccaaccggaccaagtccgtcctcgag
ggcaagaatatcgactggtcgacggccgaggcgctggccttcggcaccatggtgaccgag
ggccgccacgtccgcgtctcgggccaggatgtcgagcgtggtaccttctcgcagcgccac
gccgtcttccacgaccaggagaccgaagacacctacaccccgctgcagcacgtcagcaag
gaccagggcaagttcgtcatctccaactcgtccctcagcgagtacggcgctctcggcttc
gagtacggctactccctgaccgaccccaacggcttcgtcatgtgggaggcccagttcggt
gactttgccaacaacgcccaatgcatcatcgaccagttcatcgcttctggcgagcagaag
tggatgcagcgcaccggtctggtcatgtctctgccgcacggttacgacggccagggcccc
gagcactcgtcgggccgcctcgagcgcttcctccagctctgcaacgaggaccctcgtgtc
ttcccctcggccgagaagctgcagcgccagcaccaggactgcaacatccaggtcgcctac
ccgagcacccccgccaacctcttccacattctccgccgccagatgaaccgccagttccgg
aagccgctcatcctcttcttttccaagtcgctgctgcgtcacccgctcgcccggtccaac
attgaggaattcacgggcgactcgcagttccagtgggtcatcgcggatcctgctcacgag
acgggtgccatcaagccgcacgaccagatcgaccgcgtcatcatctgcaccggccaggtg
tacgccgcgctgcacaagtaccgcgccgagaagcagattgacgacgtggccttcacgcgt
atcgagcagctccaccccttcccgtgggagctgctgcgcgagaacctcgacatgtacccc
aacgccaagaccatcgtctgggcccaggaggagccgctcaacgcgggcgcctggagctac
acgcagccgcgcattgagacgctgctcaaccagaccaagcatcaccaccgcaagcacgtc
atgtacgccggccgcaaccccagcgcgtcggtcgccacgggtctgaaggcgtcgcacacc
aaggaggagcaagatctgttggagatggccttttccgtcaagcaggacaagctcaagggc
gagtaa

DBGET integrated database retrieval system