KEGG   Thermothelomyces thermophila: MYCTH_72393Help
Entry
MYCTH_72393       CDS       T02231                                 

Gene name
gla1
Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00500  Starch and sucrose metabolism
mtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCTH_72393 (gla1)
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     MYCTH_72393 (gla1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 DEC-1_N
Motif
Other DBs
NCBI-GeneID: 11507113
NCBI-ProteinID: XP_003666828
JGI: 72393
UniProt: G2QPS0
LinkDB All DBs
Position
7:join(1578424..1578646,1578718..1579087,1579184..1579257,1579317..1579448,1579514..>1580597)
Genome map
AA seq 628 aa AA seqDB search
MHALSSLAVLGAWAVQTVLGRPATLSKRATDSFIETETPIAWEKLRCNIGANGCAASGAA
AGVVIASPSKSDPDYFYTWTRDAGLVLTGIVDALSQNYSAALQTNIQDYIIAQAKLQGVS
NPSGSLSDGTGLGEPKFNVDLTQFTGDWGRPQRDGPPLRAIALIRYAKWLASNGYKDTAN
SVVWPVIKNDLAYAAQYWNETGFDLWEEVPGSSFFTIASTHRALVEGAALAAQLGTECSA
CITVAPQVLCFQQSFWNPSGGYVVSNINGGNNRSGKDLNSVLASIHTFDPAVGCDSVTFQ
PCSDKALSNHKAYVDSFRSVYAINSGIAQGKAVAVGRYSEDVYYNGNPWYLANFAAAEQL
YDAVFVWKKQQSIEVTQLSLPFFKDLLPGISTGTYTPSSSTYQQILDAVSAYADGFIDVA
AKYTPSDGSLAEQYTRDSGQPISAKDLTWSYAAFLSAADRRAGIVPAGWSAEHGKTLPGS
CSAVQVAGTYTQATATSFPPGQTPNPTSDTPAPFPTACADSTQVFVTFRAEVTTQWGQSV
KVVGSSSELGNWDVSKAPRLSASAYTASDPLWAITVPMKAGQSVQYKFVKVNGDGSIQWE
SDPNRQFTVSSSSTASGCAWQTIEATWR
NT seq 1883 nt NT seq  +upstreamnt  +downstreamnt
atgcacgctctctcgtcgctcgctgtcctcggcgcctgggccgtccagacggtcttgggc
cgtccggccaccctctcaaagcgggccaccgactccttcatcgagaccgagacgcctatc
gcatgggaaaagctgcggtgcaacatcggcgctaacggctgtgcggcttccggagccgct
gccggtgtggtcattgccagcccgtccaagtcggatccagactacttctacacctggact
cgagatgccggcctggtcctgacgggtatcgtggacgccctgtcccaaaactactcggcg
gccctgcagaccaacattcaggactacatcatcgcccaggccaagctccagggtgtttcg
aacccctccggtagcctctcggacggcaccggtcttggcgagcccaagttcaatgtcgat
ctcacccagttcacgggcgactggggccggccgcagcgcgacggtccgcctctccgggcc
atcgccctcatccgctacgccaagtggctggcttccaacggttacaaggacacggccaac
agcgtcgtctggcccgtcatcaagaacgacctggcctatgccgctcagtattggaacgag
actggtttcgacctgtgggaggaggttcccggcagctcgttcttcaccattgccagcacg
caccgagccttggtagagggagctgccctcgctgcccagctcggcaccgaatgcagcgcc
tgcatcaccgtcgcgccccaagtcctctgcttccagcagagcttctggaacccgtcgggc
ggttacgttgtctcgaacatcaacggcggcaacaaccggtccggcaaggatctcaactcg
gtcctggcctccatccacacctttgacccggcggtcggctgcgactcggtcaccttccag
ccctgcagcgacaaggcgctctccaaccacaaggcctacgtcgactccttccgcagcgtc
tacgccatcaactcgggcattgcccagggcaaggccgtcgccgtgggccgctactcggag
gacgtctactacaacggcaacccgtggtacctggccaacttcgcggccgccgagcagctc
tacgacgccgtcttcgtctggaagaagcagcagtccatcgaggtcacccagctgtccctc
cccttcttcaaggacctgctccccggcatctccaccggcacctacaccccgtcgtcgtcg
acgtaccagcagatcctcgacgccgtctcggcctacgccgacggcttcatcgacgtcgcg
gccaagtacaccccctcggacggctccctggccgagcagtacacgcgcgactcgggccag
ccgatctcggccaaggacctgacctggtcctacgccgccttcctctcggccgccgaccgc
cgcgcgggcatcgtcccggccggctggtccgccgagcacggcaagacgctgcccggctcg
tgctcggccgtccaggtcgccggcacctacacccaggccaccgccacctccttcccgccc
ggccagacgcccaacccgaccagcgacaccccggccccgttccccacggcctgcgccgac
tccacccaggtcttcgtcaccttccgcgccgaggtgaccacccagtggggccagtcggtc
aaggtcgtcggcagctcgtccgagctcggcaactgggacgtctccaaggccccgcgcctg
tccgcgtcggcctacacggcgtcggacccgctctgggccatcacggtgcccatgaaggcc
ggccagtcggtgcagtacaagttcgtcaaggtcaacggggacgggtcgatccagtgggag
tcggacccgaaccgccagttcacggtcagctcttcctccacggccagcggctgtgcctgg
cagaccatcgaggcgacctggcg

DBGET integrated database retrieval system