KEGG   Thermothelomyces thermophila: MYCTH_77970Help
Entry
MYCTH_77970       CDS       T02231                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00250  Alanine, aspartate and glutamate metabolism
mtm00410  beta-Alanine metabolism
mtm00430  Taurine and hypotaurine metabolism
mtm00650  Butanoate metabolism
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
Module
mtm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MYCTH_77970
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCTH_77970
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCTH_77970
   00430 Taurine and hypotaurine metabolism
    MYCTH_77970
Enzymes [BR:mtm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MYCTH_77970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 SUZ-C
Motif
Other DBs
NCBI-GeneID: 11508066
NCBI-ProteinID: XP_003660028
JGI: 77970
UniProt: G2Q703
LinkDB All DBs
Position
1:complement(join(6890977..6891865,6891959..6892797,6892933..6892950))
Genome map
AA seq 581 aa AA seqDB search
MSLSRQVDPEEIIQHFQDLRTPSTSPSSLGGGRGEHLTPFSTPYASQRDIPKYQIPQDGA
PGDTVYEMIKDELDLDGRPNLNLASFVDTYLEGNAQRLMVENLSKNLADNDEYPAMLAIS
NRCVSILAHLWGVRKGERAVGAPTVGSSEAIHLGGLAMKRRWQERRRAQGRDTARPNIVM
GANAQVALLKFARYFEVEERVLPVSAKSRYCLDPDLVRENIDENTIGVFVILGSTYTGHY
EPVEEISRILDQFQEKTGVDIPIHVDAASGGFVAPFTHAGAGGRKWNFELPRVVSINSSG
HKYGLVTAGVGWIIWRDQSYLSRDLIFELHYLGGTEESFTLNFSRPGSQVIVQYYNLIHL
GFSGYREIMENCLANARILSQSLEATGWYTCISEIHRPLAPPSPAAGAGPGPRGRRRRVK
GAVTGQPAAPDGEGTTGTTTTTTTETSAGYVAGLPVVSFRLTDEFRREYPHVRQETISLL
LRARQWIVPNYALPPGEDGTEILRVVVRVSMSFDLLDRLVTDIVQVTETLMERDEVDLSV
LPAQHVGPRPRVKKREGERLKDVGREAGKKRMTGGIHRSVC
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtctctatcgcgccaggtcgatccggaggagatcattcagcacttccaagacctgcgc
acgccctcgacgagccccagctccctaggaggaggaagaggagaacatctgacccccttc
tcgaccccctacgccagccagcgcgacatccccaagtaccagatcccgcaggacggcgcg
ccgggcgacacggtgtacgagatgatcaaggacgagctggacctcgacggcaggccgaac
ctcaacctggccagcttcgtcgacacgtacctcgagggcaacgcgcagcggctcatggtc
gagaacctgagcaagaacctggccgacaacgacgagtacccggccatgctggccatctcg
aaccggtgcgtctccatcctggcgcacctgtggggggtgcgcaagggcgagagggccgtc
ggcgcccccaccgtcggctcctccgaggccatccacctcggcggcctggccatgaagcgc
cgctggcaggagcggcggcgggcccagggcagggacacggcgcgccccaacatcgtcatg
ggcgccaacgcccaggtcgccctgctcaagttcgcgaggtacttcgaggtggaggagcgg
gtgctgcccgtgtcggccaagagcaggtactgcctggacccggacctggtcagggagaac
atcgacgagaacacgatcggcgtctttgtgatcctggggagcacgtacacggggcattac
gagcccgtcgaggagatcagccggatcctggaccagttccaggagaagaccggggtcgac
atccccatccacgtggacgcggccagcggtggtttcgtagccccgtttacccacgcaggg
gccggcgggcggaagtggaactttgagctcccccgggtagtctccatcaacagctcaggt
cacaagtatggtctagtaacggccggagtcggctggatcatctggcgcgaccagtcctac
ctctcccgggacctcatctttgagttgcactacctcggcgggaccgaggagtccttcacc
ctcaacttctcccgcccgggctcgcaggtgatcgtgcagtactacaacctcatccacctc
ggcttctcgggctaccgcgagatcatggagaactgcctggccaacgcccgcatcctctcc
cagagcctcgaggccaccggttggtacacctgcatcagcgagatccaccggccgttggcg
ccgcccagccccgccgctggggcagggcctgggcctcggggccgccgccgtcgcgtcaag
ggggccgtcacgggccaacccgccgcgccggacggggaggggacgacggggacgacgacg
acgacgacgaccgagacgtcggcgggttacgtcgccgggctgcccgtcgtctctttccgg
ctgacggacgagttccggcgcgagtacccgcacgtccggcaggagaccatctcgctcctg
ctgcgggcgcgccagtggatcgtgcccaactacgcgctcccgcccggcgaggacggcacc
gagatcctgcgcgtcgtcgtccgcgtcagcatgagcttcgacctgctcgaccgcctggtg
accgacatcgtgcaggtgaccgagacgctgatggagcgggacgaggtggacctgtcggtg
ctgcccgcgcagcacgtgggcccgcggccgcgggtgaagaagcgggagggggagaggctg
aaggacgtcgggagggaggccgggaagaagaggatgacgggcgggatccatcggtccgtc
tgctga

DBGET integrated database retrieval system